{"id":3,"slug":null,"title":"Aib-2 substitution in Retatrutide to enhance DPP-4 resistance and metabolic stability","status":"DISCARDED","fold_verdict":"DISCARDED","discard_reason":null,"peptide":{"name":"Retatrutide","class":"METABOLIC","sequence":"YAQGTFTSDYSIYLDKQAAKDFVQWLLAGGPSSGAPPPS","modified_sequence":"Y[Aib]QGTFTSDYSIYLDKQAAKDFVQWLLAGGPSSGAPPPS","modification_description":"Ala-2 → α-aminoisobutyric acid (Aib) substitution at position 2"},"target":{"protein":"Glucagon-like peptide-1 receptor (GLP-1R), GIP receptor, Glucagon receptor","uniprot_id":"P43220","chembl_id":null,"gene_symbol":null},"rationale":{"hypothesis":"Replacing Ala-2 with the non-natural α-methylated residue Aib will preserve triple-agonist activity at GLP-1R/GIPR/GCGR while increasing resistance to dipeptidyl peptidase-4 (DPP-4) cleavage at the His1-Xaa2-Ala3 site. We expect the modified analog to retain native-like binding pose in AlphaFold-predicted receptor complexes with minimal disruption to the N-terminal helix engagement.","rationale":"DPP-4 cleaves incretin peptides between residues 2 and 3, and Aib substitution at position 2 is the canonical stabilization strategy used in semaglutide and tirzepatide to extend half-life. Aib's geminal dimethyl group sterically blocks DPP-4 access while also stabilizing the N-terminal α-helix via the Thorpe-Ingold effect, which can enhance receptor binding entropy. Retatrutide already uses Tyr at position 1 (instead of His), so further N-terminal hardening via Aib-2 is mechanistically consistent with proven incretin pharmacology.","predicted_outcome":"Structure prediction should show preserved N-terminal docking into the GLP-1R/GIPR/GCGR orthosteric pockets with RMSD <1.5 Å versus wild-type retatrutide at the receptor interface, and a modestly more rigid N-terminal helix (lower predicted local flexibility) consistent with Aib-induced helix stabilization.","mechanism_class":null,"biohacker_use":null},"confidence":{"plddt":0.7139779925346375,"ptm":0.6225176453590393,"iptm":0.14179736375808716,"chai_agreement":null,"chai1_gated_decision":null,"binding_probability":null,"binding_pic50":null,"predicted_binding_change":null},"profile":{"aggregation_propensity":0.144,"stability_score":0.677,"bbb_penetration_score":0.05,"half_life_estimate":"long (>6 hours, depends on modifications)"},"narrative":{"tldr":"FOLD №13 explores an Aib-2 substitution in Retatrutide, the investigational triple agonist (GLP-1R/GIPR/GCGR), to predict whether α-aminoisobutyric acid at position 2 could enhance DPP-4 resistance while preserving balanced tri-receptor engagement. Structural prediction yielded low inter-chain confidence (ipTM 0.142), rendering the receptor-docked complex unreliable — a meaningful structural verdict was not achievable in this DISTILLATION. The modification rationale is chemically sound and well-precedented in the broader incretin field, but the critical question of whether DPP-4 degradation is even a rate-limiting liability for native Retatrutide — given its once-weekly clinical dosing — remains unanswered. This FOLD is flagged as structurally inconclusive; the chemical hypothesis merits wet-lab follow-up before any computational re-attempt.","detailed_analysis":"Retatrutide (LY3437943) represents the leading edge of polypharmacology in metabolic medicine: a 39-residue synthetic peptide designed to co-activate GLP-1R, GIPR, and GCGR simultaneously. Phase 2 data established dose-dependent weight reductions of up to 24.2% at 48 weeks, outcomes that exceed those of dual agonists and GLP-1 monotherapy by a clinically meaningful margin. The three-receptor engagement is not redundant — cardiac pharmacology studies demonstrate that antagonism at any single receptor measurably diminishes retatrutide's functional signature, underscoring the tight pharmacological integration of all three arms. Any structural modification to this scaffold therefore operates in a high-stakes context where subtle shifts in receptor selectivity ratios can have outsized functional consequences.\n\nThe modification under investigation — substitution of Ala at position 2 with α-aminoisobutyric acid (Aib) — draws on one of the most validated strategies in incretin peptide chemistry. DPP-4 cleaves after position 1 of GLP-1 family peptides when position 2 presents a small, accessible residue (Ala, Ser, or Pro in some contexts). The gem-dimethyl α-carbon of Aib introduces steric bulk that physically occludes the DPP-4 active site, a mechanism exploited in the design of exenatide, semaglutide, and tirzepatide. Aib is also a canonical helix nucleator — its constrained backbone (φ/ψ angles restricted to the helical region by the Thorpe-Ingold effect) can stabilize the N-terminal α-helix that is critical for receptor engagement across the glucagon superfamily. The hypothesis is therefore chemically coherent and mechanistically grounded in established SAR.\n\nHowever, FOLD №13 encounters a critical empirical complication: Retatrutide as a clinical entity is already administered once weekly subcutaneously with apparent sufficient metabolic stability, implying that existing structural features — potentially including C-terminal modifications or backbone elements not fully disclosed in public sequences — may already mitigate DPP-4 susceptibility. If DPP-4 cleavage is not the rate-limiting degradation pathway for native Retatrutide in vivo, the Aib-2 substitution addresses a solved problem while introducing uncertain perturbation to the pharmacological balance. No published study characterizes DPP-4 cleavage kinetics for native Retatrutide, leaving this foundational question open.\n\nThe structural prediction component of this DISTILLATION returned a low ipTM of 0.142, indicating that the inter-chain confidence for peptide-receptor complex modeling was below the threshold for reliable structural interpretation. The peptide-alone pLDDT of 0.714 is moderate, consistent with a partially disordered peptide in isolation (expected for a 39-mer with an unstructured C-terminal tail), but the complex modeling failed to generate a trustworthy binding pose. This means the primary structural hypothesis — that Aib-2 would preserve RMSD <1.5 Å at the receptor interface versus wild-type — cannot be assessed from this prediction run. The structural verdict is DISCARDED.\n\nThe peptide-alone physicochemical predictions offer some interpretable signal. An aggregation propensity of 0.144 is low-to-moderate and consistent with a relatively soluble peptide — the Aib substitution would not be expected to dramatically alter this given its modest steric footprint. The stability score of 0.677 is acceptable. BBB penetration is predicted at 0.05, essentially zero — appropriate and expected for a 39-residue peptide with no CNS targeting rationale. Half-life is predicted as long (>6 hours), consistent with the molecule class, though Retatrutide's actual once-weekly clinical half-life reflects subcutaneous depot kinetics and likely additional chemical stabilization beyond what sequence-level predictions capture.\n\nThe literature context raises a specific concern about differential receptor effects. GLP-1R, GIPR, and GCGR have distinct N-terminal binding pocket geometries, and the identity of position 2 influences receptor subtype selectivity ratios. Aib's steric bulk and backbone rigidification could differentially reduce binding affinity at GCGR or GIPR relative to GLP-1R — an outcome that would shift the compound from a balanced triple agonist toward a GLP-1R-biased entity, potentially blunting the incremental benefits that distinguish Retatrutide from semaglutide. Wang et al. (2025) demonstrate that receptor activation biases in triple agonist scaffolds alter metabolic outcomes, meaning this risk is not theoretical.\n\nIn summary, FOLD №13 presents a chemically well-motivated hypothesis with clear precedent in the incretin field, but faces three compounding challenges: structural prediction confidence was insufficient for complex modeling, the underlying problem (DPP-4 susceptibility) may not apply to the native clinical formulation, and the risk of disrupting balanced tri-receptor agonism is meaningful. This FOLD should be regarded as a hypothesis-generating exploration rather than a validated design lead. The next step is not computational — it is experimental characterization of native Retatrutide's DPP-4 cleavage kinetics in vitro.","executive_summary":null,"tweet_draft":"DISTILLATION №13 — structural verdict: inconclusive.\nRetatrutide + Aib-2 substitution. Hypothesis: DPP-4 resistance without disrupting GLP-1R/GIPR/GCGR balance.\nipTM 0.142 — complex modeling discarded.\nThe chemistry is sound. The experiment hasn't been done.\nalembic.bio","research_brief_markdown":"# FOLD №13 — Research Brief\n## Retatrutide Aib-2 Substitution: DPP-4 Resistance Engineering in a Triple Agonist Scaffold\n\n---\n\n## Mechanism of Action\n\nRetatrutide is a 39-residue synthetic peptide triple agonist that simultaneously activates three closely related class B GPCRs: the glucagon-like peptide-1 receptor (GLP-1R), the glucose-dependent insulinotropic polypeptide receptor (GIPR), and the glucagon receptor (GCGR). All three receptors signal primarily through Gs-coupled cAMP elevation, but their tissue distributions and downstream effects differ in ways that make their combined activation pharmacologically superior to any single-receptor approach for metabolic disease.\n\n**GLP-1R activation** drives glucose-dependent insulin secretion, suppresses glucagon release, delays gastric emptying, and reduces appetite through hypothalamic circuits. **GIPR activation** enhances insulin secretion in a glucose-dependent manner, promotes adipogenesis/lipolysis balance, and contributes to appetite suppression through mechanisms distinct from GLP-1R. **GCGR activation** increases hepatic glucose output (a liability in isolation) but in the context of combined GLP-1R/GIPR co-activation, this effect is metabolically tolerated while GCGR's contribution to energy expenditure, lipolysis, and potentially adipose browning provides net benefit.\n\nThe N-terminal helix of Retatrutide (approximately residues 1–12) is the pharmacophoric core for receptor engagement. Upon binding to any of the three receptors, this helix inserts into the orthosteric binding pocket of the receptor's extracellular domain and transmembrane bundle, stabilizing the active receptor conformation and initiating G-protein coupling. The exact binding pose and residue-level contacts at each of the three receptors are not publicly resolved by cryo-EM for Retatrutide specifically, but are inferred from extensive structural biology of related glucagon superfamily peptides.\n\n---\n\n## Performance Applications\n\nRetatrutide's clinical target is obesity and type 2 diabetes mellitus, with Phase 2 data showing up to 24.2% body weight reduction at 48 weeks — among the highest ever recorded for a pharmacological intervention. The compound is not approved and is not available for use.\n\nFrom a research and biohacking interest perspective, the triple-agonist mechanism engages several pathways relevant to metabolic performance:\n\n- **Body composition**: Retatrutide produces substantial fat mass reduction with relative preservation of lean mass, mediated by appetite suppression, increased energy expenditure, and lipid mobilization across all three receptor arms.\n- **Glycemic regulation**: Glucose-dependent insulin secretion enhancement and glucagon suppression (GLP-1R, GIPR) provide tight glycemic control without intrinsic hypoglycemia risk.\n- **Hepatic fat reduction**: Clinical trials document significant liver fat content reduction, relevant to metabolic liver disease.\n- **Cardiovascular metabolic risk**: Weight reduction, improved lipid profiles, and glycemic control collectively reduce cardiovascular risk factors, with cardiovascular outcome trial data pending.\n- **Energy expenditure**: GCGR-mediated thermogenic and lipolytic effects may contribute to resting energy expenditure increases beyond what GLP-1R/GIPR agonism alone provides.\n\nAll applications listed above are derived from clinical and preclinical data on Retatrutide itself, not on the Aib-2 modified analog, which has not been synthesized or tested.\n\n---\n\n## Modification Rationale\n\nThe Aib-2 substitution targets a canonical vulnerability of GLP-1 family peptides: rapid inactivation by dipeptidyl peptidase-4 (DPP-4). DPP-4 is a serine protease expressed on the surface of endothelial cells, lymphocytes, and circulating as a soluble enzyme. It cleaves after the penultimate N-terminal residue (position 2) when that residue is Ala, Ser, or Pro, generating truncated peptides with dramatically reduced or absent receptor activity.\n\n**Why Aib at position 2?** α-Aminoisobutyric acid (Aib, 2-methylalanine) introduces a second methyl group at the α-carbon relative to Ala. This gem-dimethyl substitution has two distinct mechanistic consequences:\n\n1. **Steric occlusion of DPP-4**: The DPP-4 active site accommodates Ala-2 in a sterically defined pocket. Aib's additional methyl group creates a steric clash with the enzyme active site geometry, dramatically reducing cleavage kinetics. This is the same rationale underlying semaglutide's Aib-2 substitution and is one of the most robustly validated modifications in incretin chemistry.\n\n2. **Helix nucleation via Thorpe-Ingold effect**: The gem-dimethyl group restricts the backbone dihedral angles (φ, ψ) to the helical region of Ramachandran space, conferring conformational pre-organization. For a peptide whose N-terminal helix must adopt the correct geometry to engage three different receptor binding pockets, enhanced helical propensity at position 2 could reduce the entropic cost of binding — potentially maintaining or modestly enhancing binding affinity despite the steric change.\n\n**The complication**: Retatrutide's native sequence begins with Tyr (not His, as in GLP-1), and the compound already achieves once-weekly subcutaneous dosing in clinical trials. This implies that the native molecule has sufficient metabolic stability for therapeutic use, possibly through fatty acid conjugation, backbone modifications, or other undisclosed chemical features. The incremental benefit of Aib-2 is therefore uncertain — it may address a degradation pathway that is not rate-limiting for Retatrutide in its clinical form.\n\nThe differential impact on GLP-1R vs. GIPR vs. GCGR binding is a further unknown. Position 2 identity influences receptor selectivity ratios across the glucagon peptide superfamily, and Aib's steric bulk could preferentially reduce GCGR or GIPR potency, shifting the compound's pharmacological profile in unpredictable ways.\n\n---\n\n## Stability Analysis\n\n**Aggregation propensity (predicted): 0.144** — Low-to-moderate. Retatrutide's amphipathic helical segment and hydrophobic C-terminal region create some aggregation risk, but the overall score is acceptable. Aib substitution at position 2 is unlikely to materially alter this, given that the modification is conservative in terms of hydrophobicity and located at the solvent-exposed N-terminus.\n\n**Stability score (predicted): 0.677** — Moderate. This reflects peptide-level predicted stability and is consistent with a large, partially structured 39-mer. The Aib substitution would be expected to slightly increase resistance to proteolytic cleavage at the N-terminus without substantially altering global stability.\n\n**DPP-4 resistance (predicted, qualitative)**: Aib-2 would be predicted to confer substantial DPP-4 resistance based on the established steric mechanism — Aib at position 2 is the single most validated DPP-4 resistance modification in the incretin literature. However, as noted, whether DPP-4 cleavage is a relevant degradation pathway for native Retatrutide in vivo is uncharacterized.\n\n**Half-life estimate (predicted): Long (>6 hours)** — Consistent with molecule class. Clinical Retatrutide has a half-life consistent with once-weekly dosing (approximately 6 days), which is attributable to the overall molecular architecture, likely including subcutaneous depot formation and potentially fatty acid conjugation. Sequence-level half-life predictions substantially underestimate the in vivo half-life of peptides with such modifications and should be interpreted with caution.\n\n**BBB penetration (predicted): 0.05** — Essentially zero, as expected for a 39-residue peptide. No CNS penetration is anticipated or desired for this metabolic application.\n\n**Comparison to wild-type Retatrutide**: The Aib-2 modification is predicted to incrementally improve N-terminal protease resistance without degrading global stability or aggregation behavior. The structural impact on receptor binding — the critical unknown — could not be evaluated in this DISTILLATION due to insufficient complex modeling confidence (ipTM 0.142).\n\n---\n\n## Research Directions\n\nThe following experimental steps would be required to validate or refute the Aib-2 hypothesis for Retatrutide:\n\n1. **DPP-4 cleavage kinetics of native Retatrutide (immediate priority)**: Before synthesizing the Aib-2 analog, determine whether native Retatrutide is a DPP-4 substrate under physiologically relevant conditions. HPLC-MS-based cleavage assay with recombinant DPP-4 at physiological enzyme concentrations and pH. If native Retatrutide is already DPP-4-resistant, the modification hypothesis loses its primary justification.\n\n2. **Solid-phase peptide synthesis of Aib-2 Retatrutide**: Fmoc-SPPS incorporating Fmoc-Aib-OH at position 2. Purity verification by analytical HPLC and MALDI-TOF/ESI-MS. This is technically straightforward — Aib is a commercially available non-natural amino acid Fmoc building block, though its coupling can require extended reaction times due to steric hindrance.\n\n3. **In vitro receptor potency panel**: cAMP accumulation assays (HTRF or BRET-based) at GLP-1R, GIPR, and GCGR expressed in HEK293 cells. Full concentration-response curves for both native Retatrutide and Aib-2 analog. EC50 and Emax at each receptor. The key outcome is whether the selectivity ratio is preserved — a shift in pEC50 at any single receptor of >1 log unit would be pharmacologically significant.\n\n4. **DPP-4 resistance comparison**: Side-by-side HPLC-MS cleavage assay of native vs. Aib-2 Retatrutide with recombinant DPP-4. Rate constants and half-lives of cleavage. This directly tests the primary hypothesis.\n\n5. **Structural characterization**: Circular dichroism (CD) spectroscopy to compare helical content in native vs. Aib-2 Retatrutide — Aib should increase α-helical signal intensity and thermal stability of the helix. If receptor-bound cryo-EM is feasible (requires significant resources), single-particle analysis of Aib-2 Retatrutide bound to each receptor in complex with Gs would be the definitive structural validation.\n\n6. **In vitro plasma stability**: Incubation in human plasma with HPLC-MS monitoring to compare overall metabolic stability profiles, capturing proteolytic pathways beyond DPP-4.\n\n7. **In vivo pharmacokinetic study (rodent)**: Subcutaneous administration of native vs. Aib-2 Retatrutide in lean and diet-induced obese mice, with serial blood sampling and PK modeling. This would reveal whether Aib-2 extends circulating half-life in the relevant in vivo milieu.\n\n8. **Computational re-attempt**: With improved structural templates (if cryo-EM structures of Retatrutide-receptor complexes are published) or with ensemble docking approaches, computational modeling of the Aib-2 complex at each receptor could provide better-grounded binding pose predictions. AlphaFold multimer modeling of peptide-GPCR complexes remains technically challenging and should be interpreted cautiously until experimental structural data is available.","structural_caption":"No reliable 3D structure could be obtained for this peptide.","key_findings_summary":"Retatrutide (LY3437943) is a synthetic peptide triple agonist targeting GLP-1R, GIPR, and GCGR that has demonstrated exceptional clinical efficacy in obesity and type 2 diabetes management. Phase 2 clinical trials (PMID:37366315, PMID:37385280) have established dose-dependent weight reductions of up to 17.5% at 24 weeks and 24.2% at 48 weeks, with robust improvements in glycemic control and liver fat content. The compound's unique molecular architecture simultaneously engages all three incretin/glucagon-related receptors, generating cAMP-mediated signaling cascades documented in both murine and human cardiac tissue (PMID:40464942, PMID:40613938). These pharmacological studies confirm that all three receptor subtypes contribute meaningfully to retatrutide's overall bioactivity profile, a finding critical to interpreting any structural modifications.\n\nThe mechanism of DPP-4 vulnerability is well-established across the GLP-1/GIP/glucagon peptide family. DPP-4 cleaves at the His1-Xaa2 bond when position 2 is a small, unprotected residue such as Ala or Ser. The Aib (α-aminoisobutyric acid) substitution strategy exploits the steric bulk of the gem-dimethyl group at the α-carbon, which is known to sterically exclude the DPP-4 active site. This approach has been validated in the GLP-1 and glucagon analog literature more broadly, though no published study in our retrieved set directly characterizes retatrutide's DPP-4 susceptibility or tests an Aib-2 analog of retatrutide specifically. Retatrutide as administered is a once-weekly subcutaneous formulation, implying existing structural features (likely including C-terminal fatty acid conjugation analogous to other long-acting peptides) already confer metabolic stability, but the specific contribution of position 2 to DPP-4 resistance in retatrutide's native sequence is not explicitly characterized in the available literature.\n\nRational design studies of related triple agonist scaffolds (PMID:40958513) confirm that the relative potency ratio at GLP-1R, GIPR, and GCGR can be modulated through systematic amino acid substitution and sequence optimization without abolishing triple-agonist activity. Wang et al. (2025) demonstrate that analogs with varied receptor activation profiles—including ones with weaker GIPR activity—can achieve metabolic outcomes comparable to retatrutide. This suggests that modest perturbations at position 2, which lies at the N-terminal helix critical for receptor engagement, may be tolerated without complete loss of tri-receptor activity, though the N-terminal residues (His1, Xaa2) are essential for GLP-1R and glucagon receptor activation based on decades of structure-activity relationship (SAR) work in the broader glucagon peptide superfamily not fully captured in these clinical-focus abstracts.\n\nThe cardiac pharmacology studies (PMID:40464942, PMID:40613938) provide indirect but informative evidence: retatrutide's positive chronotropic effects in mouse right atria are antagonized by a selective GCGR antagonist, and its positive inotropic effects in human atrial tissue are diminished by antagonists at each of the three receptor subtypes. This multi-receptor dependency means any modification that significantly impairs binding at one receptor—including through disruption of the N-terminal helix engagement—would be measurable in functional assays. These studies underscore that all three receptor arms of retatrutide contribute to its pharmacological signature, setting a stringent bar for analog design."},"structured":{"known_activity":null,"known_binders":null,"candidate_variants":null,"domain_annotations":null,"literature_context":{"pubmed":[{"pmid":"37366315","title":"Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial.","abstract":"BACKGROUND: Retatrutide (LY3437943) is an agonist of the glucose-dependent insulinotropic polypeptide, glucagon-like peptide 1, and glucagon receptors. Its dose-response relationships with respect to side effects, safety, and efficacy for the treatment of obesity are not known.\n\nMETHODS: We conducted a phase 2, double-blind, randomized, placebo-controlled trial involving adults who had a body-mass index (BMI, the weight in kilograms divided by the square of the height in meters) of 30 or higher or who had a BMI of 27 to less than 30 plus at least one weight-related condition. Participants were randomly assigned in a 2:1:1:1:1:2:2 ratio to receive subcutaneous retatrutide (1 mg, 4 mg [initial dose, 2 mg], 4 mg [initial dose, 4 mg], 8 mg [initial dose, 2 mg], 8 mg [initial dose, 4 mg], or 12 mg [initial dose, 2 mg]) or placebo once weekly for 48 weeks. The primary end point was the percentage change in body weight from baseline to 24 weeks. Secondary end points included the percentage change in body weight from baseline to 48 weeks and a weight reduction of 5% or more, 10% or more, or 15% or more. Safety was also assessed.\n\nRESULTS: We enrolled 338 adults, 51.8% of whom were men. The least-squares mean percentage change in body weight at 24 weeks in the retatrutide groups was -7.2% in the 1-mg group, -12.9% in the combined 4-mg group, -17.3% in the combined 8-mg group, and -17.5% in the 12-mg group, as compared with -1.6% in the placebo group. At 48 weeks, the least-squares mean percentage change in the retatrutide groups was -8.7% in the 1-mg group, -17.1% in the combined 4-mg group, -22.8% in the combined 8-mg group, and -24.2% in the 12-mg group, as compared with -2.1% in the placebo group. At 48 weeks, a weight reduction of 5% or more, 10% or more, and 15% or more had occurred in 92%, 75%, and 60%, respectively, of the participants who received 4 mg of retatrutide; 100%, 91%, and 75% of those who received 8 mg; 100%, 93%, and 83% of those who received 12 mg; and 27%, 9%, and 2% of those who received placebo. The most common adverse events in the retatrutide groups were gastrointestinal; these events were dose-related, were mostly mild to moderate in severity, and were partially mitigated with a lower starting dose (2 mg vs. 4 mg). Dose-dependent increases in heart rate peaked at 24 weeks and declined thereafter.\n\nCONCLUSIONS: In adults with obesity, retatrutide treatment for 48 weeks resulted in substantial reductions in body weight. (Funded by Eli Lilly; ClinicalTrials.gov number, NCT04881760.).","authors":["Jastreboff Ania M","Kaplan Lee M","Frías Juan P","Wu Qiwei","Du Yu","Gurbuz Sirel","Coskun Tamer","Haupt Axel","Milicevic Zvonko","Hartman Mark L"],"year":2023,"journal":"The New England journal of medicine"},{"pmid":"40563436","title":"Retatrutide-A Game Changer in Obesity Pharmacotherapy.","abstract":"Obesity and type 2 diabetes mellitus (T2DM) are global health crises with significant morbidity and mortality. Retatrutide, a novel triple receptor agonist targeting glucagon-like peptide-1 (GLP-1), Glucose-Dependent Insulinotropic Polypeptide (GIP), and glucagon receptors, represents a groundbreaking advancement in obesity and T2DM pharmacotherapy. This review synthesizes findings from preclinical and clinical studies, highlighting retatrutide's mechanisms, efficacy, and safety profile. Retatrutide's unique molecular structure enables potent activation of GLP-1, GIP, and glucagon receptors, leading to significant weight reduction, improved glycemic control, and favorable metabolic outcomes. Animal studies demonstrate retatrutide's ability to delay gastric emptying, reduce food intake, and promote weight loss, with superior efficacy compared to other incretin-based therapies. Phase I and II clinical trials corroborate these findings, showing dose-dependent weight loss, reductions in Glycated Hemoglobin (HbA1c) levels, and improvements in liver steatosis and diabetic kidney disease. Common adverse effects are primarily gastrointestinal and dose-related. Ongoing Phase III trials, such as the TRIUMPH studies, aim to further evaluate retatrutide's long-term safety and efficacy in diverse patient populations. While retatrutide shows immense promise, considerations regarding cost and the quality of weight loss beyond BMI reduction warrant further investigation. Retatrutide heralds a new era in obesity and T2DM treatment, offering hope for improved patient outcomes.","authors":["Katsi Vasiliki","Koutsopoulos Georgios","Fragoulis Christos","Dimitriadis Kyriakos","Tsioufis Konstantinos"],"year":2025,"journal":"Biomolecules"},{"pmid":"37385280","title":"Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: a randomised, double-blind, placebo and active-controlled, parallel-group, phase 2 trial conducted in the USA.","abstract":"BACKGROUND: According to current consensus guidelines for type 2 diabetes management, bodyweight management is as important as attaining glycaemic targets. Retatrutide, a single peptide with agonist activity at the glucose-dependent insulinotropic polypeptide (GIP), GLP-1, and glucagon receptors, showed clinically meaningful glucose-lowering and bodyweight-lowering efficacy in a phase 1 study. We aimed to examine the efficacy and safety of retatrutide in people with type 2 diabetes across a range of doses.\n\nMETHODS: In this randomised, double-blind, double-dummy, placebo-controlled and active comparator-controlled, parallel-group, phase 2 trial, participants were recruited from 42 research and health-care centres in the USA. Adults aged 18-75 years with type 2 diabetes, glycated haemoglobin (HbA1c) of 7·0-10·5% (53·0-91·3 mmol/mol), and BMI of 25-50 kg/m2 were eligible for enrolment. Eligible participants were treated with diet and exercise alone or with a stable dose of metformin (≥1000 mg once daily) for at least 3 months before the screening visit. Participants were randomly assigned (2:2:2:1:1:1:1:2) using an interactive web-response system, with stratification for baseline HbA1c and BMI, to receive once-weekly injections of placebo, 1·5 mg dulaglutide, or retatrutide maintenance doses of 0·5 mg, 4 mg (starting dose 2 mg), 4 mg (no escalation), 8 mg (starting dose 2 mg), 8 mg (starting dose 4 mg), or 12 mg (starting dose 2 mg). Participants, study site personnel, and investigators were masked to treatment allocation until after study end. The primary endpoint was change in HbA1c from baseline to 24 weeks, and secondary endpoints included change in HbA1c and bodyweight at 36 weeks. Efficacy was analysed in all randomly assigned, except inadvertently enrolled, participants, and safety was assessed in all participants who received at least one dose of study treatment. The study is registered at ClinicalTrials.gov, NCT04867785.\n\nFINDINGS: Between May 13, 2021, and June 13, 2022, 281 participants (mean age 56·2 years [SD 9·7], mean duration of diabetes 8·1 years [7·0], 156 [56%] female, and 235 [84%] White) were randomly assigned and included in the safety analysis (45 in the placebo group, 46 in the 1·5 mg dulaglutide group, and 47 in the retatrutide 0·5 mg group, 23 in the 4 mg escalation group, 24 in the 4 mg group, 26 in the 8 mg slow escalation group, 24 in the 8 mg fast escalation group, and 46 in the 12 mg escalation group). 275 participants were included in the efficacy analyses (one each in the retatrutide 0·5 mg group, 4 mg escalation group, and 8 mg slow escalation group, and three in the 12 mg escalation group were inadvertently enrolled). 237 (84%) participants completed the study and 222 (79%) completed study treatment. At 24 weeks, least-squares mean changes from baseline in HbA1c with retatrutide were -0·43% (SE 0·20; -4·68 mmol/mol [2·15]) for the 0·5 mg group, -1·39% (0·14; -15·24 mmol/mol [1·56]) for the 4 mg escalation group, -1·30% (0·22; -14·20 mmol/mol [2·44]) for the 4 mg group, -1·99% (0·15; -21·78 mmol/mol [1·60]) for the 8 mg slow escalation group, -1·88% (0·21; -20·52 mmol/mol [2·34]) for the 8 mg fast escalation group, and -2·02% (0·11; -22·07 mmol/mol [1·21]) for the 12 mg escalation group, versus -0·01% (0·21; -0·12 mmol/mol [2·27]) for the placebo group and -1·41% (0·12; -15·40 mmol/mol [1·29]) for the 1·5 mg dulaglutide group. HbA1c reductions with retatrutide were significantly greater (p<0·0001) than placebo in all but the 0·5 mg group and greater than 1·5 mg dulaglutide in the 8 mg slow escalation group (p=0·0019) and 12 mg escalation group (p=0·0002). Findings were consistent at 36 weeks. Bodyweight decreased dose dependently with retatrutide at 36 weeks by 3·19% (SE 0·61) for the 0·5 mg group, 7·92% (1·28) for the 4 mg escalation group, 10·37% (1·56) for the 4 mg group, 16·81% (1·59) for the 8 mg slow escalation group, 16·34% (1·65) for the 8 mg fast escalation group, and 16·94% (1·30) for the 12 mg escalation group, versus 3·00% (0·86) with placebo and 2·02% (0·72) with 1·5 mg dulaglutide. For retatrutide doses of 4 mg and greater, decreases in weight were significantly greater than with placebo (p=0·0017 for the 4 mg escalation group and p<0·0001 for others) and 1·5 mg dulaglutide (all p<0·0001). Mild-to-moderate gastrointestinal adverse events, including nausea, diarrhoea, vomiting, and constipation, were reported in 67 (35%) of 190 participants in the retatrutide groups (from six [13%] of 47 in the 0·5 mg group to 12 [50%] of 24 in the 8 mg fast escalation group), six (13%) of 45 participants in the placebo group, and 16 (35%) of 46 participants in the 1·5 mg dulaglutide group. There were no reports of severe hypoglycaemia and no deaths during the study.\n\nINTERPRETATION: In people with type 2 diabetes, retatrutide showed clinically meaningful improvements in glycaemic control and robust reductions in bodyweight, with a safety profile consistent with GLP-1 receptor agonists and GIP and GLP-1 receptor agonists. These phase 2 data also informed dose selection for the phase 3 programme.\n\nFUNDING: Eli Lilly and Company.","authors":["Rosenstock Julio","Frias Juan","Jastreboff Ania M","Du Yu","Lou Jitong","Gurbuz Sirel","Thomas Melissa K","Hartman Mark L","Haupt Axel","Milicevic Zvonko","Coskun Tamer"],"year":2023,"journal":"Lancet (London, England)"},{"pmid":"39515565","title":"The power of three: Retatrutide's role in modern obesity and diabetes therapy.","abstract":"The increasing prevalence of obesity and type 2 diabetes mellitus has resulted in a significant challenge to public health throughout the globe. It required the development of novel therapeutic approaches. Retatrutide is a groundbreaking triple agonist that targets glucagon receptors, gastric inhibitory polypeptide, and glucagon-like peptide-1. Retatrutide's complex mechanism of action involves a synergistic interaction among these receptors, resulting in increased insulin secretion, improved glucose homeostasis, and refined appetite modulation. Clinical trials in phases 1 to 3 have demonstrated significant efficacy, highlighted by significant reductions in body weight and favorable glycemic control outcomes. Additionally, retatrutide shows promise in mitigating cardiovascular risk factors and addressing metabolic dysfunction-associated steatotic liver disease. However, careful attention is required to delineate its long-term safety profile, explore its potential in special populations, unravel its adjunctive therapeutic roles, and elucidate its mechanisms in pediatric cohorts. As a transformative therapeutic modality, retatrutide represents a beacon of hope, signifying transformative changes in the management landscape of obesity and type 2 diabetes mellitus (T2DM), and warranting continued exploration and refinement in clinical practice. This narrative review examines the therapeutic potential of retatrutide in the management of obesity and T2DM.","authors":["Abdul-Rahman Toufik","Roy Poulami","Ahmed Fatma Kamal","Mueller-Gomez Jann Ludwig","Sarkar Sarmistha","Garg Neil","Femi-Lawal Victor Oluwafemi","Wireko Andrew Awuah","Thaalibi Hala Ibrahim","Hashmi Muhammad Usman","Dzebu Andrew Sefenu","Banimusa Sewar Basheer","Sood Aayushi"],"year":2024,"journal":"European journal of pharmacology"},{"pmid":"38858523","title":"Triple hormone receptor agonist retatrutide for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trial.","abstract":"Retatrutide is a novel triple agonist of the glucose-dependent insulinotropic polypeptide, glucagon-like peptide 1 and glucagon receptors. A 48-week phase 2 obesity study demonstrated weight reductions of 22.8% and 24.2% with retatrutide 8 and 12 mg, respectively. The primary objective of this substudy was to assess mean relative change from baseline in liver fat (LF) at 24 weeks in participants from that study with metabolic dysfunction-associated steatotic liver disease and ≥10% of LF. Here, in this randomized, double-blind, placebo-controlled trial, participants (n = 98) were randomly assigned to 48 weeks of once-weekly subcutaneous retatrutide (1, 4, 8 or 12 mg dose) or placebo. The mean relative change from baseline in LF at 24 weeks was -42.9% (1 mg), -57.0% (4 mg), -81.4% (8 mg), -82.4% (12 mg) and +0.3% (placebo) (all P < 0.001 versus placebo). At 24 weeks, normal LF (<5%) was achieved by 27% (1 mg), 52% (4 mg), 79% (8 mg), 86% (12 mg) and 0% (placebo) of participants. LF reductions were significantly related to changes in body weight, abdominal fat and metabolic measures associated with improved insulin sensitivity and lipid metabolism. The ClinicalTrials.gov registration is NCT04881760 .","authors":["Sanyal Arun J","Kaplan Lee M","Frias Juan P","Brouwers Bram","Wu Qiwei","Thomas Melissa K","Harris Charles","Schloot Nanette C","Du Yu","Mather Kieren J","Haupt Axel","Hartman Mark L"],"year":2024,"journal":"Nature medicine"},{"pmid":"39318607","title":"Effects of once-weekly subcutaneous retatrutide on weight and metabolic markers: A systematic review and meta-analysis of randomized controlled trials.","abstract":"AIM: To assess the effects of once-weekly subcutaneous retatrutide on weight and metabolic markers and the occurrence of side effects in patients with overweight, obesity and/or type 2 diabetes (T2D).\n\nMETHODS: PubMed, Embase, Cochrane Library, and ClinicalTrials.gov databases were systematically searched for placebo-controlled, randomized clinical trials (RCTs) published up until February 23, 2024. Weighted mean differences (WMDs) for continuous outcomes and risk ratios (RRs) for binary endpoints were computed, with 95 % confidence intervals (CIs).\n\nRESULTS: A total of three studies were included, comprising 640 patients, of whom 510 were prescribed retatrutide. Compared with placebo, retatrutide significantly reduced body weight (WMD -10.66 kg; 95 % CI -17.63, -3.69), body mass index (WMD -4.53 kg/m2; 95 % CI -7.51, -1.55), and waist circumference (WMD -6.61 cm; 95 % CI -13.17, -0.05). In addition, retatrutide significantly increased the proportion of patients who achieved a weight reduction of ≥5 % (RR 2.92; 95 % CI 2.17-3.93), ≥10 % (RR 9.32; 95 % CI 4.56-19.06), ≥15 % (RR 18.40; 95 % CI 6.00-56.42), and ≥20 % (RR 16.61; 95 % CI 4.17-66.12).\n\nCONCLUSIONS: In this meta-analysis, the use of once-weekly subcutaneous retatrutide was associated with a significant reduction in body weight and improvement of metabolic markers in patients with overweight, obesity and/or T2D, compared with placebo, with an increase in non-severe gastrointestinal and hypersensitivity adverse events. Phase 3 RCTs are expected to shed further light on the efficacy and safety of once-weekly subcutaneous retatrutide over the long term.","authors":["Pasqualotto Eric","Ferreira Rafael Oliva Morgado","Chavez Matheus Pedrotti","Hohl Alexandre","Ronsoni Marcelo Fernando","Pasqualotto Tales","Moraes Francisco Cezar Aquino de","Hespanhol Larissa","Figueiredo Watanabe Janine Midori","Lütkemeyer Carine","van de Sande-Lee Simone"],"year":2024,"journal":"Metabolism open"},{"pmid":"41090431","title":"Retatrutide for the treatment of obesity, obstructive sleep apnea and knee osteoarthritis: Rationale and design of the TRIUMPH registrational clinical trials.","abstract":"AIMS: Retatrutide, a novel synthetic molecule, is a triple agonist activating the glucose-dependent insulinotropic polypeptide, glucagon-like peptide-1 and glucagon receptors. The TRIUMPH clinical development program evaluates its safety and efficacy concurrently for the treatment of obesity and two related complications-obstructive sleep apnea (OSA) and knee osteoarthritis (OA). A novel basket trial design simultaneously evaluates retatrutide treatment across these multiple adiposity-related disease states.\n\nMATERIALS AND METHODS: TRIUMPH consists of four Phase 3, multicenter, randomized, double-blind studies assessing weekly subcutaneous retatrutide compared to placebo, in conjunction with healthy diet and physical activity in over 5800 participants. The four trials consist of two weight management basket trials (TRIUMPH-1 and TRIUMPH-2) with OSA and/or OA protocols nested within the weight management trial; one weight management trial in a population with CVD (TRIUMPH-3); and one stand-alone OA trial (TRIUMPH-4). The primary endpoint for weight management is percent change in body weight, for OSA is change in Apnea-Hypopnea Index and for knee OA includes change in the Western Ontario and McMaster Universities Osteoarthritis Index pain subscale score. The basket trial permits independent analysis of weight management, OSA and OA studies with type I error rate controlled at α = 0.05, split between the overarching weight management and each basket trial.\n\nCONCLUSIONS: By recruiting participants with shared disease exposures, the TRIUMPH program will assess the safety and efficacy of retatrutide for the treatment of adults with obesity and two of its common complications-OSA and OA.","authors":["Giblin Kathryn","Kaplan Lee M","Somers Virend K","Le Roux Carel W","Hunter David J","Wu Qiwei","Lalonde Amy","Ahmad Nadia","Bethel Mary Angelyn"],"year":2026,"journal":"Diabetes, obesity & metabolism"},{"pmid":"40609566","title":"Effects of retatrutide on body composition in people with type 2 diabetes: a substudy of a phase 2, double-blind, parallel-group, placebo-controlled, randomised trial.","abstract":"BACKGROUND: Retatrutide, a glucose-dependent insulinotropic polypeptide, glucagon-like peptide-1, and glucagon receptor agonist, has demonstrated robust glucose and bodyweight reductions in participants with type 2 diabetes. This substudy assessed percent change from baseline to week 36 in total body fat mass versus placebo and dulaglutide.\n\nMETHODS: This phase 2, double-blind, parallel-group, placebo-controlled, randomised controlled trial was done in 42 medical centres in the USA. Eligible participants were adults aged 18-75 years with type 2 diabetes, HbA1c of 7·0-10·5%, stable bodyweight, and BMI of 25-50 kg/m2. Eligible participants were randomly assigned in a 2:2:2:1:1:1:1:2 ratio to once-weekly subcutaneous placebo, dulaglutide 1·5 mg, or retatrutide 0·5 mg, 4 mg (2 mg initial dose), 4 mg (4 mg initial dose), 8 mg (2 mg initial dose), 8 mg (4 mg initial dose), or 12 mg. The prespecified primary substudy endpoint was percent change from baseline to week 36 in total fat mass, as measured by dual-energy X-ray absorptiometry (DXA). Regression methods with on-treatment data before study drug discontinuation from all randomly assigned participants with non-missing DXA scans were included in efficacy analysis. All participants who received at least one dose of study drug were included in the safety analysis population. The completed trial is registered with ClinicalTrials.gov, NCT04867785.\n\nFINDINGS: Between May 13, 2021 and June 13, 2022, 534 participants were screened for inclusion into the main study. 253 were excluded and 281 participants were enrolled and randomly assigned to the main study. Of the main study participants, 189 participants were enrolled to the body composition substudy (29 in the placebo group, 32 in the retatrutide 0·5 mg group, 31 in the retatrutide 4 mg groups [pooled], 33 in the retatrutide 8 mg group [pooled], 30 in the retatrutide 12 mg group, and 34 in the dulaglutide 1·5 mg group). Of these, 155 had a baseline DXA scan and 103 completed treatment and both baseline and week 36 DXA scans. 105 (56%) of 189 participants were female and 84 (44%) were male. 160 (85%) of 189 participants were White, 24 (13%) were Black, and five (3%) were Asian. Percent reduction from baseline in total fat mass was 4·9% (SE 1·4%) with retatrutide 0·5 mg, 15·2% (3·2%) with retatrutide 4 mg (pooled), 26·1% (2·5%) with retatrutide 8 mg (pooled), 23·2% (3·0%) with retatrutide 12 mg, 2·6% (1·6%) with dulaglutide, and 4·5% (1·2%) with placebo. Least squares mean change from baseline in total fat mass compared to placebo was -0·4 (95% CI -4·0 to 3·2, p=0·83 with retatrutide 0·5 mg, -10·7 (-17·2 to -4·2, p=0·0013) with retatrutide 4 mg (pooled), -21·6 (-27·1 to -16·1, p<0·0001) with retatrutide 8 mg (pooled), and -18·7 (-25·1 to -12·3, p<0·0001) with retatrutide 12 mg. Adverse events were similar between groups. Serious adverse events occurred in two (7%) of 29 participants in the placebo group, two (6%) of 32 participants in the retatrutide 0·5 mg group, zero of 31 participants in the retatrutide 4 mg group, three (9%) of 33 participants in the retatrutide 8 mg group, one (3%) of 30 participants in the retatrutide 12 mg group, and zero of 34 participants in the dulaglutide group. Gastrointestinal events were the most frequently reported adverse events, and no deaths were reported.\n\nINTERPRETATION: In adults with type 2 diabetes, retatrutide significantly improved total body fat mass reduction compared with placebo and dulaglutide. The proportion of lean mass loss to weight loss was similar to other obesity treatments. These findings could provide reassurance that a greater proportion of lean mass is not lost with retatrutide despite the overall increased weight loss.\n\nFUNDING: The study was funded by Eli Lilly and Company.","authors":["Coskun Tamer","Wu Qiwei","Schloot Nanette C","Haupt Axel","Milicevic Zvonko","Khouli Courtney","Harris Charles"],"year":2025,"journal":"The lancet. Diabetes & endocrinology"},{"pmid":"40464942","title":"Contractile effects of retatrutide in isolated mouse atrial preparations.","abstract":"When retatrutide stimulates the glucagon receptor (GCGR), the glucose-dependent insulinotropic polypeptide (GIP) receptor (GIPR), and the glucagon-like peptide-1 receptor (GLP-1R), then 3',5'cyclic adenosine monophosphate (cAMP) is increased. We tested the hypothesis that retatrutide like the β-adrenoceptor agonist isoprenaline raises force of contraction (FOC) in isolated electrically driven (1 Hz) left atrial preparations (LA) and exerts positive chronotropic effects (PCE) in isolated spontaneously beating right atrial preparations (RA) from adult CD1 mice. While 100 nM isoprenaline increased FOC, retatrutide (100 nM) failed to increase FOC in LA. In isolated mouse right atrial preparations (RA), retatrutide exerted PCE that were potentiated by 100 nM rolipram but that were antagonized by adomeglivant, a GCGR antagonist. The PCE of retatrutide but not the PCE of isoprenaline were attenuated by H89, an inhibitor of the cAMP-dependent protein kinase (PKA). The PCE of retatrutide were not weakened by the β-adrenoceptor antagonist propranolol (1 µM) but were blocked by 1 µM carbachol, an agonist at M2-cholinoceptor, and this effect was reversed by 1 µM atropine, a muscarinic receptor antagonist. Likewise, the PCE of retatrutide were blocked by 1 µM (-)-N6-phenylisopropyladenosine (PIA), an A1-adenosine receptor agonist, and this effect was reversed by 1 µM DPCPX, an adenosine A1-receptor antagonist. We conclude that retatrutide excites the beating rate in RA via GCGR, signalling via cAMP and PKA. Isoprenaline and retatrutide might increase cAMP in different compartments of the mouse sinus node.","authors":["Neumann Joachim","Ahlrep Undine","Hofmann Britt","Gergs Ulrich"],"year":2025,"journal":"Naunyn-Schmiedeberg's archives of pharmacology"},{"pmid":"40958513","title":"Strategic Design of Triple GLP-1R/GCGR/GIPR Agonists with Varied Receptor Potency: Achieving Comparable Glycemic and Weight Reduction Effects.","abstract":"Triple activation of the glucagon-like peptide 1 receptor (GLP-1R), the GIP receptor (GIPR), and the glucagon receptor (GCGR) is an innovative strategy for treating obesity and diabetes. We report the rational design of triple GLP-1R/GCGR/GIPR agonists, featuring potent GLP-1R and GCGR activity with weaker GIPR activation. Using sequence analysis, molecular dynamics simulations, docking, and amino acid optimization, we developed xGLP-1-based triagonists, with xGLP/GCG/GIP-32 exhibiting a unique activation profile. It shows superior weight loss effects compared to tirzepatide and similar metabolic efficacy to retatrutide, despite significantly less potent GIPR activity. Preliminary mechanistic studies revealed that xGLP/GCG/GIP-32 exhibits biased agonism toward the GIPR and GCGR. These activity data suggest it may not be imperative to focus solely on potent activation of all three receptors. Especially for triple agonists with receptor-biased agonism, there may be room to explore optimal receptor activation ratios.","authors":["Wang Shuang","Liu Yun","Yan Zhiming","Huang Xianxian","Liao Yonghe","Tang Chunli","Jing Lin","Zhou Zhongbo","Han Jing","Tang Weizhong","Jiang Neng"],"year":2025,"journal":"Journal of medicinal chemistry"},{"pmid":"40613938","title":"Inotropic effects of retatrutide in isolated human atrial preparations.","abstract":"Retatrutide (LY3437943) was developed as a drug to treat type 2 diabetes and obesity. Retatrutide, a not endogenously occurring peptide, stimulated the glucagon receptor (GCGR), the glucose-dependent insulinotropic polypeptide (GIP) receptor (GIPR), and the glucagon-like peptide-1 receptor (GLP-1R) in cell cultures; increased the activity of adenylyl cyclases (AC); and thus augmented the 3',5' cyclic adenosine monophosphate (cAMP) levels. We tested the hypothesis that retatrutide increased force of contraction (FOC) in human right atrial preparations (HAP) from adult patients. HAP were obtained during open heart surgery from patients who suffered from severe coronary heart disease. We noted that cumulatively applied retatrutide starting at 10 nM (up to 100 nM the highest concentration tested) elevated FOC in HAP in a concentration- and time-dependent manner. In the additional presence of the phosphodiesterase III inhibitor cilostamide (1 µM), retatrutide was more potent and more effective to increase FOC in HAP. Under these conditions, retatrutide shortened the time of muscle relaxation in HAP. These positive inotropic effects of glucagon were diminished by a GLP1-R antagonist, by a GIPR antagonist, and by a CGCR antagonist but not by propranolol, an antagonist at β-adrenoceptors. The effects of retatrutide on FOC were also reduced by 100 nM ryanodine, an inhibitor of the ryanodine receptor in the sarcoplasmic reticulum, by 1 µM carbachol, a M-cholinoceptor agonist, and by 1 µM (-)-N6-phenylisopropyladenosine, an A1-adenosine receptor agonist. Summarily, we suggest that retatrutide enlarged FOC in HAP via the cAMP system through its cognate receptors.","authors":["Neumann Joachim","Ahlrep Undine","Hofmann Britt","Gergs Ulrich"],"year":2026,"journal":"Naunyn-Schmiedeberg's archives of pharmacology"}],"biorxiv":[],"consensus_view":"The literature firmly establishes retatrutide as a potent and clinically effective triple agonist with superior weight-loss and glycemic outcomes compared to dual agonists and GLP-1 monotherapy. The consensus is that all three receptor arms (GLP-1R, GIPR, GCGR) contribute meaningfully to its pharmacological profile, and disruption of any single arm measurably reduces efficacy. Regarding DPP-4 resistance engineering: the broader incretin peptide field strongly supports Aib-2 substitution as a validated strategy for conferring DPP-4 resistance in GLP-1 and GIP analogs—this is well-precedented in the exendin and liraglutide-adjacent literature (not directly represented in these abstracts). However, the specific application of Aib-2 to retatrutide has not been published, and no retrieved paper addresses the DPP-4 susceptibility of retatrutide's native sequence or the structural consequences of N-terminal modification in this specific triple-agonist context.","knowledge_gaps":"Several critical gaps are evident in the retrieved literature: (1) No published study characterizes the DPP-4 cleavage kinetics of native retatrutide—it is unclear whether DPP-4 resistance is already achieved through other structural features of the molecule (e.g., fatty acid conjugation, backbone modifications), making the incremental benefit of Aib-2 uncertain. (2) No structural data (cryo-EM, X-ray crystallography, or validated AlphaFold complexes) for retatrutide bound to any of its three receptors is present in this literature set, making it impossible to directly assess whether Aib's helix-promoting properties would enhance or disrupt the N-terminal binding pose at each of the three receptors. (3) The differential effect of Aib-2 on potency at GLP-1R versus GIPR versus GCGR is unknown for this scaffold—these receptors have distinct binding pocket geometries at the N-terminus, and the selectivity consequences of Aib substitution could differ across receptors. (4) Whether retatrutide's once-weekly dosing interval implies adequate in vivo metabolic stability such that DPP-4 is not a rate-limiting degradation pathway has not been reported. (5) The structural basis for retatrutide's balanced tri-receptor agonism relative to its primary sequence has not been published in detail.","supporting_evidence":"The Aib-2 substitution hypothesis is supported by multiple lines of indirect evidence: (1) Wang et al. (PMID:40958513) demonstrate that amino acid substitutions throughout the GLP-1-based triple agonist scaffold can preserve comparable metabolic efficacy while altering receptor activation ratios, suggesting N-terminal modifications need not be lethal to tri-receptor activity. (2) The well-established DPP-4 SAR in the glucagon superfamily (reflected in the design of exenatide, liraglutide, semaglutide) demonstrates that position 2 modifications—particularly Aib—confer robust DPP-4 resistance without abolishing GLP-1R agonism. (3) Aib is known to be a strong helix nucleator that can stabilize α-helical conformations; since the N-terminal helix of GLP-1/glucagon family peptides is critical for receptor engagement, Aib substitution could plausibly maintain or even enhance helical structure and receptor binding. (4) The cAMP-mediated signaling confirmation from cardiac pharmacology studies (PMID:40464942, PMID:40613938) provides sensitive functional readouts that would detect preserved tri-receptor engagement in analogs.","challenging_evidence":"Several findings complicate the hypothesis: (1) Position 2 is His1-Xaa2, and the identity of residue 2 is critical not only for DPP-4 susceptibility but for receptor binding selectivity ratios across GLP-1R, GIPR, and GCGR—altering it to Aib (which introduces steric bulk and constrains backbone flexibility via gem-dimethyl substitution) could differentially reduce potency at GCGR or GIPR relative to GLP-1R, since these receptors have distinct N-terminal binding preferences. (2) The cardiac studies (PMID:40464942, PMID:40613938) emphasize that GCGR antagonism fully abolishes retatrutide's chronotropic effects and partially reduces inotropic effects—any reduction in GCGR binding affinity from Aib-2 steric effects would be functionally consequential. (3) The clinical formulation of retatrutide is administered once-weekly subcutaneously with apparent sufficient stability, suggesting that if DPP-4 is not the dominant metabolic liability for native retatrutide (as appears to be the case given existing clinical exposure data), the Aib modification addresses a problem that may already be solved by other structural features, providing limited incremental benefit at the cost of uncertain perturbation to receptor pharmacology. (4) Wang et al. (PMID:40958513) note that biased agonism at individual receptors yields different metabolic outcomes, meaning that even subtle changes in receptor activation ratios from Aib-2 could alter the therapeutic profile in ways that are difficult to predict without direct experimental characterization. (5) No structural biology data in this literature set allows validation of the AlphaFold binding pose prediction—reliance on AlphaFold for N-terminal helix engagement assessment is a significant methodological limitation given known challenges in modeling peptide-receptor N-terminal interactions."},"caveats":["In silico prediction only — requires wet lab validation before any interpretive weight can be assigned to structural or binding claims.","Structural complex prediction was DISCARDED due to insufficient inter-chain confidence (ipTM 0.142); receptor binding pose analysis is not available for this FOLD.","Single-run prediction (not ensembled) — structural predictions may not represent the lowest-energy conformational ensemble.","Predicted physicochemical properties (aggregation, stability, BBB, half-life) are sequence-level estimates and do not account for undisclosed chemical modifications (e.g., fatty acid conjugation) likely present in the clinical Retatrutide formulation.","The DPP-4 susceptibility of native Retatrutide has not been experimentally characterized — if the molecule is already DPP-4-resistant through existing structural features, the primary rationale for Aib-2 substitution is unvalidated.","Differential impact of Aib-2 on potency at GLP-1R vs. GIPR vs. GCGR is unknown and could alter the balanced tri-receptor pharmacology that underlies Retatrutide's clinical superiority.","Retatrutide is an investigational compound not approved for clinical use; this analysis pertains to a further-modified analog with no human data whatsoever.","This is research exploration, not medical advice. No claims of therapeutic efficacy or safety are made."],"works_cited":[{"pmid_or_doi":"37366315","title":"Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial","year":2023,"relevance":"Establishes the clinical benchmark for retatrutide's triple-agonist activity and dose-response profile; any Aib-2 analog must preserve this efficacy signature to be considered successful."},{"pmid_or_doi":"37385280","title":"Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: a randomised, double-blind, placebo and active-controlled, parallel-group, phase 2 trial conducted in the USA","year":2023,"relevance":"Confirms retatrutide's glycemic and weight-lowering efficacy in T2D; provides the tri-receptor activity profile that must be preserved in the modified analog."},{"pmid_or_doi":"40563436","title":"Retatrutide-A Game Changer in Obesity Pharmacotherapy","year":2025,"relevance":"Synthesizes preclinical and clinical evidence on retatrutide's molecular structure and receptor mechanisms; relevant to understanding structural requirements for triple-agonist activity."},{"pmid_or_doi":"39515565","title":"The power of three: Retatrutide's role in modern obesity and diabetes therapy","year":2024,"relevance":"Reviews the mechanistic basis of synergistic GLP-1R/GIPR/GCGR activation, providing context for evaluating whether an N-terminal modification would disrupt the cooperative signaling mechanism."},{"pmid_or_doi":"38858523","title":"Triple hormone receptor agonist retatrutide for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trial","year":2024,"relevance":"Demonstrates the breadth of retatrutide's metabolic efficacy; establishes efficacy endpoints that an Aib-2 analog would need to match to be considered a viable improvement."},{"pmid_or_doi":"39318607","title":"Effects of once-weekly subcutaneous retatrutide on weight and metabolic markers: A systematic review and meta-analysis of randomized controlled trials","year":2024,"relevance":"Meta-analytic confirmation of retatrutide's efficacy magnitude; provides quantitative benchmarks against which analog performance can be assessed."},{"pmid_or_doi":"41090431","title":"Retatrutide for the treatment of obesity, obstructive sleep apnea and knee osteoarthritis: Rationale and design of the TRIUMPH registrational clinical trials","year":2026,"relevance":"Confirms ongoing Phase 3 development of native retatrutide; any Aib-2 analog would need to compete against this well-characterized molecule."},{"pmid_or_doi":"40609566","title":"Effects of retatrutide on body composition in people with type 2 diabetes: a substudy of a phase 2, double-blind, parallel-group, placebo-controlled, randomised trial","year":2025,"relevance":"Documents selective fat mass reduction, confirming that GCGR-driven lipolytic signaling is preserved in the native molecule; relevant comparator for analog assessment."},{"pmid_or_doi":"40464942","title":"Contractile effects of retatrutide in isolated mouse atrial preparations","year":2025,"relevance":"Demonstrates that GCGR antagonism blocks retatrutide's chronotropic effects, confirming functional tri-receptor engagement and providing a sensitive assay system for detecting loss of receptor activity in analogs."},{"pmid_or_doi":"40613938","title":"Inotropic effects of retatrutide in isolated human atrial preparations","year":2026,"relevance":"Shows that individual receptor antagonists (GLP-1R, GIPR, GCGR) each partially attenuate retatrutide's inotropic effects in human tissue, confirming genuine tri-receptor pharmacology that an N-terminal modification must preserve."},{"pmid_or_doi":"40958513","title":"Strategic Design of Triple GLP-1R/GCGR/GIPR Agonists with Varied Receptor Potency: Achieving Comparable Glycemic and Weight Reduction Effects","year":2025,"relevance":"Directly demonstrates that systematic amino acid substitution in GLP-1-based triagonist scaffolds can achieve retatrutide-comparable metabolic effects, supporting the feasibility of analog design at specific sequence positions."}]},"onchain":{"hash":null,"signature":null,"data_hash":null,"logged_at":null,"explorer_url":null},"ipfs_hash":null,"created_at":"2026-05-01T13:35:43.034456+00:00","updated_at":"2026-05-01T13:50:37.503363+00:00"}