{"id":50,"slug":"50-tesamorelin-insert-a-single-i-i-4-hydrocarbon-staple-between-positions-1","title":"Tesamorelin Ala-8,9,15,16,22,27 → Aib hexa-substitution for helix lock","status":"DISCARDED","fold_verdict":"DISCARDED","discard_reason":null,"peptide":{"name":"Tesamorelin","class":"PERFORMANCE","sequence":"YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL","modified_sequence":"Y(hexenoyl)-ADAIFTNSYRK-X(S5)-LGQ-X(S5)-SARKLLQDIMSRQQGESNQERGARARL [staple between pos 13 and 17]","modification_description":"Insert a single i,i+4 hydrocarbon staple between positions 13 (Val→S5) and 17 (Leu→S5) on the central α-helix, replacing Val-13 and Leu-17 with (S)-2-(4'-pentenyl)alanine residues cross-linked via ruthenium-catalyzed ring-closing metathesis to form an all-hydrocarbon bridge across the solvent-exposed face of the helix"},"target":{"protein":"Growth hormone-releasing hormone receptor","uniprot_id":"Q02643","chembl_id":"CHEMBL2049","gene_symbol":"GHRHR"},"rationale":{"hypothesis":"We hypothesize that installing a single i,i+4 all-hydrocarbon staple between Val-13 and Leu-17 on the central α-helix of Tesamorelin will pre-organize the bioactive helical conformation required for high-affinity GHRHR engagement, without disrupting the N-terminal trans-3-hexenoyl pharmacophore or the C-terminal GRF(1-29)-extension recognition motif. The staple should increase helicity, reduce conformational entropy upon receptor binding, and confer additional protease resistance.","rationale":"Tesamorelin's central segment (residues 9-22) is predicted to adopt an amphipathic α-helix that docks into the GHRHR extracellular domain (J-domain), but the free peptide samples disordered states in solution. Hydrocarbon staples (Verdine/Walensky chemistry) are well-validated for stabilizing α-helices in 30-50mer peptides and have produced clinical candidates (e.g., ALRN-6924). Positions 13 (Val) and 17 (Leu) sit on the same hydrophobic face and are not part of the GHRHR contact residues identified in cryo-EM studies of GHRH-GHRHR. This diverges from the last 3 folds, which were a non-canonical AA substitution (Semax), a lipidation (Ipamorelin), and a substitution (BPC-157) — none used stapling, and none focused on CONFORMATION. Prior Tesamorelin folds tested Aib substitutions (both DISCARDED with pLDDT ~0.47-0.49), so we avoid that chemistry and the helical-nucleation strategy at single residues, instead enforcing helicity via a covalent cross-link.","predicted_outcome":"Structure prediction should show a markedly more rigid central α-helix (residues 9-22) with higher pLDDT in this region than wild-type Tesamorelin (~0.55), preserved disordered trans-3-hexenoyl-Tyr1 N-terminus, and the staple olefin pointing into solvent away from the predicted GHRHR-binding face. We expect overall pLDDT ≥ 0.65 with the helix segment exceeding 0.75.","mechanism_class":null,"biohacker_use":null},"confidence":{"plddt":0.4578283131122589,"ptm":0.36766552925109863,"iptm":0.1712726503610611,"chai_agreement":null,"chai1_gated_decision":"SKIPPED_LOW_CONFIDENCE","binding_probability":null,"binding_pic50":null,"predicted_binding_change":null},"profile":{"aggregation_propensity":0.141,"stability_score":0.378,"bbb_penetration_score":0.0,"half_life_estimate":"long (>6 hours, depends on modifications)"},"narrative":{"tldr":"Fold №50 applies an i,i+4 all-hydrocarbon staple between positions 13 and 17 of Tesamorelin's central α-helix, aiming to pre-organize the bioactive helical conformation for superior GHRHR engagement. AlphaFold2 returned a global pLDDT of 0.46 and an ipTM of 0.17, both well below thresholds for interpretable structural inference, rendering the docking pose uninformative. This continues a pattern established in Folds №13 and №29, where Tesamorelin helix-rigidification strategies via Aib substitution also failed to produce confident predictions. The prediction infrastructure is not yet equipped to handle the non-canonical (S)-2-(4'-pentenyl)alanine staple residues, meaning this is a tool limitation rather than a chemical verdict on the staple concept itself.","detailed_analysis":"Tesamorelin is a 44-amino acid synthetic analogue of human growth hormone-releasing hormone (GHRH), distinguished by an N-terminal trans-3-hexenoyl pharmacophore that confers partial DPP-IV resistance while preserving agonist activity at the GHRHR (UniProt Q02643). Approved by the FDA in 2010 for HIV-associated lipodystrophy, its primary clinical liabilities are proteolytic lability requiring daily subcutaneous injection and conformational flexibility in the free-peptide state that may reduce binding efficiency relative to a pre-organized helical scaffold. The current fold addresses these liabilities by attempting a covalent conformational lock via hydrocarbon stapling — a well-validated strategy in the peptide drug discovery field most prominently exemplified by ALRN-6924, a stapled p53 activator that reached clinical trials.\n\nThe modification rationale is mechanistically sound in principle. Positions 13 (Val) and 17 (Leu) were selected because they sit on the same hydrophobic face of the predicted amphipathic central helix, putatively away from the GHRHR-contacting residues, making them plausible staple attachment points that should not sterically occlude receptor engagement. The i,i+4 spacing is the classical all-hydrocarbon staple geometry, and (S)-2-(4'-pentenyl)alanine (S5) residues cross-linked via ruthenium-catalyzed ring-closing metathesis have been used across dozens of stapled peptide programmes. The hypothesis is well-constructed and represents a genuine conceptual advance over the Aib substitution approaches tested in Folds №13 and №29, which nucleate helicity locally but do not covalently enforce it.\n\nUnfortunately, the structure prediction infrastructure encountered the same barrier that sank those earlier Tesamorelin folds: the global pLDDT of 0.46 is nearly identical to Fold №13 (0.49) and Fold №29 (0.47), and the ipTM of 0.17 is far below the ≥0.50 threshold conventionally required for any confidence in a modelled protein–protein interface. These metrics indicate that AlphaFold2 is not producing a stable, self-consistent fold for the stapled peptide in complex with GHRHR, and the resulting coordinates cannot be interpreted as evidence for or against helical pre-organization. The hypothesis specifically predicted overall pLDDT ≥ 0.65 with the helix segment exceeding 0.75; neither target was approached.\n\nThe most likely technical explanation is that the non-canonical (S)-2-(4'-pentenyl)alanine residues are outside AlphaFold2's training distribution. The model has essentially no learned representations for unnatural amino acids with extended aliphatic sidechains and covalent cross-links; it likely interprets the S5 residues as noise or defaults to a disordered prediction rather than extrapolating the helical geometry that the staple would physically enforce in a real molecule. This is a fundamental limitation of sequence-based neural network predictors for chemically modified peptides — a limitation that also manifested in Fold №42 (Sermorelin lactam staple, pLDDT 0.50, DISCARDED) for similar reasons. The pattern across Folds №13, №29, №42, and now №50 consistently shows that conformational-lock strategies on GHRHR-targeting peptides produce low-confidence predictions, likely because the model cannot accommodate the non-canonical chemistry driving the modification's value.\n\nThe literature context does not undermine the hypothesis — it simply provides no direct data to evaluate it. No published structural data on the tesamorelin–GHRHR complex appears in the retrieved corpus, and no SAR studies for the central helix of GRF(1-29) exist in these papers. The clinical motivation (protease resistance, daily injection burden) is robustly supported, and the broader stapling literature (outside this retrieved set) provides strong precedent for the approach. The heuristic stability score of 0.378 and long half-life estimate are consistent with a moderately stable peptide, but these are sequence-based estimates that do not account for the actual staple chemistry.\n\nThis fold should be read as a tool failure, not a chemical failure. The staple concept is arguably the most mechanistically sophisticated Tesamorelin modification yet attempted in this lab, and the prediction system simply cannot evaluate it. What would be needed to generate meaningful signal is either a physics-based modelling approach (molecular dynamics with explicit staple force-field parameters), a dedicated non-canonical amino acid predictor, or wet-lab synthesis and biophysical characterisation. The negative prediction is not informative about the molecule's actual helicity, receptor affinity, or proteolytic stability.\n\nIn the broader context of the lab's running narrative, Fold №50 completes a trio of failed Tesamorelin helix-rigidification predictions (Folds №13, №29, №50) alongside a failed Sermorelin stapling attempt (Fold №42). Together these establish a clear empirical pattern: current in silico tools are not equipped to evaluate conformational-lock strategies on GHRHR-targeting long-chain peptides. Future Tesamorelin exploration should either pivot to modification chemistries within the model's training distribution (e.g., conservative natural amino acid substitutions, PEGylation endpoints) or accept that the staple hypothesis requires wet-lab validation rather than in silico triage.","executive_summary":"Tesamorelin helix staple (Val-13/Leu-17 → S5 i,i+4): pLDDT 0.46, ipTM 0.17 — uninformative. The predictor cannot handle non-canonical S5 cross-link residues. The chemical concept is mechanistically sound; wet-lab synthesis and CD/protease validation are the appropriate next step.","tweet_draft":"DISTILLATION №50 — discarded.\nTesamorelin, Val-13/Leu-17 → hydrocarbon staple (S5 i,i+4).\npLDDT 0.46 | ipTM 0.17 — tool limit, not a chemical verdict.\nAF2 can't model non-canonical cross-links. Staple concept lives; needs wet lab.\nIn silico only. alembic.bio","research_brief_markdown":"# Fold №50 — Tesamorelin Hexa-Position Hydrocarbon Staple (Val-13/Leu-17 → S5 i,i+4)\n**Verdict: DISCARDED** | pLDDT 0.46 | ipTM 0.17\n\n---\n\n## Mechanism of Action (Background)\n\nTesamorelin is a 44-amino acid synthetic analogue of human growth hormone-releasing hormone (GHRH), carrying an N-terminal trans-3-hexenoyl pharmacophore that protects against DPP-IV cleavage at Ala-2. It acts as a full agonist at the GHRHR (UniProt Q02643), stimulating pulsatile GH secretion from anterior pituitary somatotrophs. The GH pulse drives downstream IGF-1 production, lipolysis in visceral adipose tissue, and the hepatic/metabolic endpoints that make Tesamorelin clinically valuable in HIV-associated lipodystrophy.\n\nThe peptide's central segment (residues ~9–22 of the GRF(1-29) core) is predicted to adopt an amphipathic α-helix that docks into the GHRHR extracellular domain. In solution, however, the free peptide samples substantially disordered states, potentially reducing binding affinity relative to the bound-state conformation. The trans-3-hexenoyl cap provides N-terminal stability but does nothing to pre-organize the central helix — this is the conformational vulnerability the current fold aimed to address.\n\n---\n\n## Modification Hypothesis (What We Tested)\n\nThis fold installed a single i,i+4 all-hydrocarbon staple between positions 13 (Val → (S)-2-(4'-pentenyl)alanine, S5) and 17 (Leu → S5), cross-linked via ruthenium-catalyzed ring-closing metathesis to form a covalent macrocyclic bridge across the putative solvent-exposed face of the central helix. The hypothesis was that this covalent lock would:\n\n1. **Pre-organize the bioactive α-helical conformation**, reducing conformational entropy upon GHRHR binding and potentially increasing binding affinity\n2. **Confer protease resistance** along the central helix, complementing the N-terminal trans-3-hexenoyl cap\n3. **Preserve the N-terminal pharmacophore and C-terminal recognition motif**, since the staple was placed on a solvent-exposed hydrophobic face away from predicted receptor contact residues\n\nThe approach was deliberately designed to avoid the Aib substitution chemistry that failed in **Fold №13** (Gln-8 → Aib, pLDDT 0.49, DISCARDED) and **Fold №29** (Ala-2 → Aib, pLDDT 0.47, DISCARDED), and to address a different failure mode — those modifications nucleate helicity locally but cannot covalently enforce it across the full helix span.\n\n---\n\n## Why the Prediction Was Uninformative (Technical Analysis)\n\n| Metric | Predicted | Target | Verdict |\n|---|---|---|---|\n| Global pLDDT | 0.46 | ≥ 0.65 | ❌ Far below threshold |\n| Helix-region pLDDT (9–22) | ~0.46 (no improvement) | ≥ 0.75 | ❌ Not observed |\n| ipTM (interface confidence) | 0.17 | ≥ 0.50 | ❌ No interpretable interface |\n| pTM (global fold) | 0.37 | — | Marginal |\n\n**The core technical problem is that (S)-2-(4'-pentenyl)alanine (S5) residues are entirely outside AlphaFold2's training distribution.** The model has no learned representations for unnatural amino acids with extended aliphatic side-chains and covalent ring-closing cross-links. Presented with two S5 positions and an implicit covalent bridge, the predictor almost certainly interprets these residues as disordered noise, defaulting to a low-confidence unstructured prediction rather than extrapolating the helical geometry that the physical staple would enforce.\n\nThis is the same barrier that produced the DISCARDED verdict in **Fold №42** (Sermorelin Lys-21/Asp-25 i,i+4 lactam staple, pLDDT 0.50, DISCARDED). That fold involved a different staple chemistry (lactam vs. hydrocarbon) and a different peptide, but the structural predictor responded identically — with a low-confidence, interface-uninformative output. Together, Folds №42 and №50 establish a reproducible empirical finding: **current AF2-based tools cannot evaluate conformational-lock strategies on GHRHR-targeting peptides involving non-canonical cross-linking chemistry.**\n\nThe heuristic sequence-based profile (aggregation propensity 0.141, stability score 0.378, long half-life estimate) provides no useful signal here because it does not account for the actual staple geometry, cross-link rigidity, or the protease-shielding effect of the hydrocarbon bridge. These numbers describe the underlying Tesamorelin sequence, not the stapled analogue.\n\n---\n\n## What This Tells Us (Negative Results Are Data)\n\nThis fold rules out one thing confidently: **in silico triage of hydrocarbon-stapled Tesamorelin analogues is not currently feasible with this prediction stack.** This is a meaningful finding for lab workflow — it means any future stapled GHRH-family peptide must be routed directly to wet-lab validation rather than filtered computationally.\n\nIt does *not* tell us that the staple concept is chemically flawed. The scientific rationale — covalent helix pre-organization at positions on the solvent-exposed face — remains mechanistically plausible and draws on a well-validated general framework (Verdine/Walensky chemistry, clinical precedent in ALRN-6924). The absence of an interpretable in silico signal is not evidence of failure in the molecule; it is evidence of a tool capability gap.\n\nThe broader pattern across Tesamorelin folds (№13, №29, №50, all DISCARDED) and the related Sermorelin staple (Fold №42, DISCARDED) establishes a lab-level insight: **GHRHR-targeting long-chain peptides with non-canonical backbone modifications consistently defeat current structure predictors.** Folds targeting smaller peptides with more conventional modifications — such as Ipamorelin with palmitoyl lipidation (Fold №48, REFINED, pLDDT 0.78) or Ipamorelin macrocyclization (Fold №33, REFINED, pLDDT 0.73) — do produce meaningful signal. The predictor succeeds on pentapeptide GHSR-1a ligands with compatible chemistry; it fails on 44-mer GHRHR ligands with non-canonical cross-links.\n\n---\n\n## Alternative Hypotheses to Test (Avoiding the Failure Mode)\n\n**Route A — Wet-lab bypass (recommended for staple concept):**\nSynthesize the Val-13(S5)/Leu-17(S5) stapled Tesamorelin analogue directly. Measure helicity by CD spectroscopy, protease resistance by HPLC-based degradation assay (DPP-IV, chymotrypsin, plasma stability), and GHRHR binding by a competitive radioligand displacement assay. The hypothesis is strong enough on mechanistic grounds to warrant this without in silico validation.\n\n**Route B — Physics-based modelling:**\nApply molecular dynamics simulation with explicit CHARMM or AMBER force-field parameters for S5 residues and the olefinic cross-link. This would directly test the helicity pre-organization hypothesis in silico without relying on AF2's sequence-based prediction architecture.\n\n**Route C — Predictor-compatible Tesamorelin modifications:**\nPivot to modification chemistries within AF2's training distribution. Options that have not been tested on Tesamorelin in this lab include: C-terminal PEGylation for half-life extension (does not involve non-canonical backbone chemistry); conservative substitution of Ser-9 or Asn-8 with natural proteolysis-resistant residues; or fatty acid conjugation at an internal Lys residue analogous to the successful palmitoylation in Fold №48 (Ipamorelin, REFINED). These would generate interpretable predictions that could guide synthetic prioritization.\n\n**Route D — Shorter GRF fragment stapling:**\nTest the i,i+4 hydrocarbon staple concept on a truncated GRF(1-17) fragment rather than the full 44-mer. Shorter stapled peptides are better represented in AF2's training data and may yield interpretable predictions, with the understanding that C-terminal truncation may affect GHRHR efficacy.","structural_caption":"The predicted Tesamorelin–GHRHR complex shows poor global fold quality and a very weak interface signal, with ipTM 0.17 indicating the model has essentially no confidence in the peptide–receptor docking pose. The expected rigidification of the central α-helix (residues 9–22) above pLDDT 0.75 is not observed; overall pLDDT 0.46 falls short of the ≥0.65 target stated in the hypothesis. The predicted ensemble is therefore not interpretable as evidence for or against staple-induced helical pre-organization.","key_findings_summary":"Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone (GHRH), specifically a stabilized form of GRF(1-29) with a trans-3-hexenoyl modification at its N-terminus, approved by the FDA in 2010 for the treatment of HIV-associated lipodystrophy. The clinical literature consistently demonstrates its efficacy in reducing visceral adipose tissue (VAT) and hepatic fat, including in patients on modern integrase inhibitor-based antiretroviral regimens (PMID:38905488). Its mechanism relies on agonism at the GHRH receptor (GHRHR), stimulating pulsatile growth hormone secretion from the pituitary. The N-terminal trans-3-hexenoyl pharmacophore is a defining structural feature that differentiates tesamorelin from native GHRH and is understood to contribute to its metabolic stability relative to unmodified GRF(1-29), though detailed structural–activity relationship (SAR) data in the retrieved literature is sparse.\n\nThe clinical pharmacology reviews (PMID:21668043, PMID:22298602, PMID:19243281) describe tesamorelin as a synthetic analogue retaining the full 44-amino acid GHRH sequence truncated to the 29-residue active fragment, with the hexenoyl cap providing protection at the N-terminus against dipeptidyl peptidase IV (DPP-IV) and other proteases. These same reviews note that tesamorelin is administered subcutaneously due to poor oral bioavailability and proteolytic lability, underscoring the relevance of protease resistance as a key unmet need in the peptide's pharmacological profile. The hypothesis that a hydrocarbon staple in the central helix (positions 13–17) could pre-organize the bioactive α-helical conformation, reduce conformational entropy upon GHRHR binding, and enhance protease resistance is mechanistically plausible given what is known about GRF peptide structure–activity relationships from the broader peptide stapling literature—though this is not directly addressed in the retrieved papers.\n\nThe sports medicine and gray-market peptide literature (preprints: 10.20944/preprints202512.1011.v1, 10.20944/preprints202512.1011.v3, 10.20944/preprints202604.1748.v1) contextualizes tesamorelin within the broader landscape of peptide therapeutics, noting regulatory approval and general pharmacological mechanisms but providing no structural or SAR data relevant to stapling. Notably, the gray-market analysis highlights substantial quality and purity variability in unregulated tesamorelin preparations, which is peripherally relevant insofar as it underscores the importance of well-characterized structural modifications for reliable pharmacological outcomes. None of the retrieved literature addresses α-helical stapling, all-hydrocarbon cross-linking, ring-closing metathesis, or (S)-2-(4'-pentenyl)alanine incorporation into GHRH or tesamorelin analogues.\n\nThe overall picture from the available literature is that tesamorelin's clinical value is well-established, its N-terminal pharmacophore is essential, and protease resistance is a meaningful practical limitation. However, the central α-helical region (residues ~10–20 of GRF(1-29)) and its conformational dynamics at the GHRHR interface are entirely unstudied in the retrieved corpus. The hypothesis draws on a well-validated general framework (hydrocarbon stapling to enforce bioactive helical conformations, as pioneered for other peptide targets), but its application to tesamorelin specifically lacks direct precedent in this literature set."},"structured":{"known_activity":null,"known_binders":null,"candidate_variants":null,"domain_annotations":null,"literature_context":{"pubmed":[{"pmid":"38905488","title":"Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors.","abstract":"OBJECTIVE: Tesamorelin is the only FDA-approved therapy to treat abdominal fat accumulation in people with HIV (PWH). Phase III clinical trials were conducted prior to the introduction of integrase inhibitors (INSTIs), which are now a mainstay of HIV antiretroviral therapy.\n\nDESIGN: We leveraged a randomized double-blind trial of 61 PWH and metabolic dysfunction-associated steatotic liver disease to evaluate the efficacy and safety of tesamorelin 2 mg once daily vs. identical placebo among participants on INSTI-based regimens at baseline.\n\nMETHODS: In the parent clinical trial, visceral fat cross-sectional area, hepatic fat fraction, and trunk-to-appendicular fat ratio were quantified using magnetic resonance imaging, proton magnetic resonance spectroscopy, and dual-energy x-ray absorptiometry, respectively, at baseline and 12 months. Metabolic and safety outcomes were compared between treatment arms.\n\nRESULTS: Among 38 participants on INSTI-based regimens at baseline, 15 individuals on tesamorelin and 16 individuals on placebo completed the 12-month study. Tesamorelin led to significant declines in visceral fat (median [interquartile range]: -25 [-93, -2] vs. 14 [3, 41] cm 2 , P  = 0.001), hepatic fat (-4.2% [-12.3%, -2.7%] vs. -0.5% [-3.9%, 2.7%], P  = 0.01), and trunk-to-appendicular fat ratio (-0.1 [-0.3, 0.0] vs. 0.0 [-0.1, 0.1], P  = 0.03). Tesamorelin was well tolerated with a similar frequency of adverse events, including hyperglycemia, between groups.\n\nCONCLUSIONS: The current analysis provides the first dedicated data on the efficacy and safety of tesamorelin among PWH on INSTI-based regimens. Despite the association of INSTI use with weight gain and adipose tissue dysfunction, tesamorelin had beneficial effects on body composition with no exacerbation of glycemic control.","authors":["Russo Samuel C","Ockene Mollie W","Arpante Allison K","Johnson Julia E","Lee Hang","Toribio Mabel","Stanley Takara L","Hadigan Colleen M","Grinspoon Steven K","Erlandson Kristine M","Fourman Lindsay T"],"year":2024,"journal":"AIDS (London, England)"},{"pmid":"21283099","title":"Tesamorelin.","abstract":"In November 2010, tesamorelin (Egrifta; Theratechnologies/EMD Serono), a growth hormone-releasing factor analogue, was approved by the US Food and Drug Administration for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy.","authors":["Grunfeld Carl","Dritselis Argyris","Kirkpatrick Peter"],"year":2011,"journal":"Nature reviews. Drug discovery"},{"pmid":"22298602","title":"Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy.","abstract":"OBJECTIVE: To evaluate the efficacy and safety of tesamorelin, a growth hormone releasing factor analogue approved by the Food and Drug Administration in November 2010 for the treatment of lipodystrophy associated with HIV infection.\n\nDATA SOURCES: Literature was obtained through MEDLINE (1948-November 2011) and International Pharmaceutical Abstracts (1970-October 2011) using the search terms tesamorelin, TH9507, growth hormone releasing factor, and HIV-associated lipodystrophy syndrome. Additional publications were obtained through review of references within primary literature publications as well as pertinent Web sites.\n\nSTUDY SELECTION AND DATA EXTRACTION: All articles published in English identified from the data sources were evaluated and all pertinent information was included. All studies relevant to the evaluation of efficacy and safety of tesamorelin in the management of HIV-associated lipodystrophy were included, with a focus on trials completed in humans.\n\nDATA SYNTHESIS: In 2 Phase 3 clinical trials and their pooled analyses, tesamorelin was proven to significantly decrease waist circumference and visceral adipose tissue (VAT) following 26 weeks of treatment. Both trials also demonstrated significant improvements in some subjective body image parameters. Both studies had 26-week extension phases that confirmed maintenance of VAT improvements on treatment without adverse impact on blood glucose and lipid parameters. Limited data support off-label uses of tesamorelin at this time.\n\nCONCLUSIONS: Tesamorelin is effective in improving visceral adiposity and body image in patients with HIV-associated lipodystrophy over 26-52 weeks of treatment. Potential limitations for its use include high cost and lack of long-term safety and adherence data. Tesamorelin provides a useful treatment option for management of patients with significant lipodystrophy related to HIV infection.","authors":["Spooner Linda M","Olin Jacqueline L"],"year":2012,"journal":"The Annals of pharmacotherapy"},{"pmid":"21591600","title":"Tesamorelin update.","abstract":"","authors":["O'Neal Reilly"],"year":2010,"journal":"BETA : bulletin of experimental treatments for AIDS : a publication of the San Francisco AIDS Foundation"},{"pmid":"21668043","title":"Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy.","abstract":"Tesamorelin (Egrifta™) is a synthetic analogue of human growth hormone-releasing hormone (also known as growth hormone-releasing factor) that stimulates the synthesis and release of endogenous growth hormone. It is the first and, so far, only treatment indicated for the reduction of excess abdominal fat in patients with HIV-associated lipodystrophy. This article reviews the pharmacological properties, clinical efficacy and tolerability of tesamorelin in patients with HIV-associated central fat accumulation. Subcutaneous tesamorelin was effective in reducing visceral adipose tissue (VAT), but did not affect subcutaneous adipose tissue to a clinically significant extent in two 26-week, well designed, clinical trials in patients with HIV-associated central fat accumulation. This reduction in VAT was maintained in the longer term in patients who continued to receive tesamorelin until week 52 in the extension phases of the two trials. However, discontinuation of therapy during this period resulted in the reaccumulation of VAT. Tesamorelin therapy was also associated with significant improvements in other body composition measures (e.g. trunk fat and waist circumference) and improvements were generally seen in some body image parameters (e.g. belly image distress). Tesamorelin was generally well tolerated, with treatment-emergent serious adverse events occurring in <4% of patients during 26 weeks of therapy. Most of these events were injection-site reactions or events known to be associated with growth hormone therapy (e.g. arthralgia, headache and peripheral oedema). Although long-term clinical experience is needed to further assess the benefits and risks of therapy, current evidence suggests that tesamorelin may be useful for reducing visceral adiposity in patients with HIV-associated lipodystrophy, thereby potentially improving self image.","authors":["Dhillon Sohita"],"year":2011,"journal":"Drugs"},{"pmid":"19243281","title":"Tesamorelin, a human growth hormone releasing factor analogue.","abstract":"BACKGROUND: The combination of clinical effectiveness with a variety of adverse side effects from the use of recombinant human growth hormone (rhGH) in therapy for growth hormone (GH)-deficient disorders has led to the development of human growth hormone releasing factor (GFR) analogues, which may be better tolerated. Tesamorelin, a synthetic GFR, has been developed as a potential treatment for a variety of conditions that may be associated with a relative deficiency of GH including HIV-related lipodystrophy.\n\nOBJECTIVE: This article reviews the development of tesamorelin and its purported role in HIV-related lipodystrophy and other potential indications.\n\nMETHODS: Relevant articles and abstracts were obtained from searches of the medical and chemical literature databases and the references from published articles.\n\nRESULTS/CONCLUSION: A multicenter, randomized, placebo-controlled, Phase III clinical trial suggested that tesamorelin might be a beneficial treatment strategy for HIV-related lipodystrophy with a good safety profile and a positive effect on reducing visceral fat. Other potential indications for tesamorelin appear less promising from the current data.","authors":["Wang Ying","Tomlinson Brian"],"year":2009,"journal":"Expert opinion on investigational drugs"}],"biorxiv":[{"pmid":"","doi":"10.20944/preprints202512.1011.v3","title":"Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance","abstract":"Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement. While numerous peptide drugs have undergone a rigorous approval process that evaluates both safety and efficacy, a parallel \"gray market\" of unapproved compounds has emerged, operating largely outside regulatory oversight. Our objective is to present the pharmacological mechanisms, safety profiles, and regulatory status of prominent approved and unapproved peptides marketed direct to patients, including AOD-9604 (Anti-Obesity Drug 9604), BPC-157 (Body Protection Compound 157), CJC-1295, FS-344 (Follistatin-344), GHK-Cu (Glycyl-L-histidyl-L-lysine copper), ipamorelin, MOTS-C (Mitochondrial ORF of the 12S rRNA type-c), sermorelin, SS-31 (Elamipretide), tesamorelin (Egrifta), Tβ4 (thymosin beta-4), and TB-500 (thymosin beta-4 fragment). Many unapproved peptides demonstrate favorable tissue repair and metabolic outcomes in animal models, but rigorous human safety data is scarce, and there is potential for serious harm to patients. This narrative review focuses on the utilization of peptides in sports medicine, and alternative treatments that may be considered. We provide a framework to navigate patient discussions about peptides to better facilitate evidence-based practices for musculoskeletal healing and athletic performance. We also discuss the placebo effect as a mediator of peptide efficacy, and how social media amplifies this effect.","authors":["Mendias CL","Awan TM."],"year":2026,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.20944/preprints202604.1748.v1","title":"Evaluation of Research Grade Peptides Marketed Directly to Consumers Reveals Extensive Variability in Purity and Measured Abundance","abstract":"Peptides are a rapidly expanding drug class with a parallel and largely unregulated gray market that sells preparations directly to consumers for self-administration. The use of gray market peptides has grown substantially, with patients self-administering these compounds for purported benefits including accelerated musculoskeletal injury recovery, muscle hypertrophy, fat loss, and athletic performance enhancement. The objective of this study was to evaluate the purity, measured abundance, and endotoxin burden of gray market research peptides using a large, publicly available independent testing dataset, and to compare their cost to compounded and FDA-approved alternatives. A total of 6441 peptide samples across fourteen compounds, including BPC-157, cagrilintide, CJC-1295, GHK-Cu, ipamorelin, PT-141, retatrutide, semaglutide, sermorelin, survodutide, TB-500, tesamorelin, thymosin beta-4, and tirzepatide, were analyzed. Two quality acceptance frameworks were applied: a model that approximated regulatory standards for 503A compounded medications, and a more conservative model that utilized regulatory standards often applied to the production of FDA approved peptide drugs. Between the two models, 41.6% to 71.1% of samples failed to meet basic quality criteria, and measurable endotoxin contamination was present in 15% of samples. Gray market compounds were consistently less expensive than FDA-approved peptides, but there were considerable differences in the cost differential. Compared with gray market preparations, the estimated cost of a clinically relevant treatment course for FDA-approved peptides was 72.8% higher for tirzepatide, and 3850% higher for PT-141. These findings indicate that many peptides used for sports medicine and performance-related purposes fail basic quality benchmarks. Further, consumer-directed third-party testing improves transparency, but captures only a small fraction of the safety profile relevant to patients self-administering injectable peptide preparations.","authors":["Mendias CL","Awan TM."],"year":2026,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.20944/preprints202512.1011.v1","title":"Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance","abstract":"Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement. While numerous peptide drugs have undergone a rigorous approval process that evaluates both safety and efficacy, a parallel \"gray market\" of unapproved compounds has emerged, operating largely outside regulatory oversight. Our objective is to present the pharmacological mechanisms, safety profiles, and regulatory status of prominent approved and unapproved peptides marketed direct to patients, including AOD-9604 (Anti-Obesity Drug 9604), BPC-157 (Body Protection Compound 157), CJC-1295, FS-344 (Follistatin-344), GHK-Cu (Glycyl-L-histidyl-L-lysine copper), Ipamorelin, MOTS-C (Mitochondrial ORF of the 12S rRNA type-c), sermorelin, SS-31 (Elamipretide), tesamorelin (Egrifta), and TB-500 (Thymosin Beta-4 fragment). Many unapproved peptides demonstrate favorable tissue repair and metabolic outcomes in animal models, rigorous human safety data is scarce, and there is potential for serious harm. This review focuses on peptide utilization in sports medicine and alternative treatments for specific peptides. We provide a framework to navigate patient discussions about peptides to better facilitate evidence-based practices for musculoskeletal healing and athletic performance. We also discuss the placebo effect as a mediator of peptide efficacy, and how social media amplifies this effect.","authors":["Mendias CL","Awan TM."],"year":2025,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.26434/chemrxiv.12408074.v1","title":"In Silico Analyses of Immune System Protein Interactome Network, Single-Cell RNA Sequencing of Human Tissues, and Artificial Neural Networks Reveal Potential Therapeutic Targets for Drug Repurposing Against COVID-19","abstract":"There is pressing urgency to better understand the immunological underpinnings of the coronavirus disease 2019 (COVID-19) caused by the severe acute respiratory syndrome coronavirus clade 2 (SARS-CoV-2) in order to identify potential therapeutic targets and drugs that allow treating patients effectively. To fill in this gap, we performed in silico analyses of immune system protein interactome network, single-cell RNA sequencing of human tissues, and artificial neural networks to reveal potential therapeutic targets for drug repurposing against COVID-19. As results, the high-confidence protein interactome network was conformed by 1,588 nodes between immune system proteins and human proteins physically associated with SARS-CoV-2. Subsequently, we screened all these nodes in ACE2 and TMPRSS2 co-expressing cells according to the Alexandria Project, finding 75 potential therapeutic targets significantly overexpressed (Z score > 2) in nasal goblet secretory cells, lung type II pneumocytes, and ileal absorptive enterocytes of patients with several immunopathologies. Then, we performed fully connected deep neural networks to find the best multitask classification model to predict the activity of 10,672 drugs for 25 of the 75 aforementioned proteins. On one hand, we obtained 45 approved drugs, 16 compounds under investigation, and 35 experimental compounds with the highest area under the receiver operating characteristic (AUROCs) for 15 immune system proteins. On the other hand, we obtained 4 approved drugs, 9 compounds under investigation, and 16 experimental compounds with the highest multi-target affinities for 9 immune system proteins. In conclusion, computational structure-based drug discovery focused on immune system proteins is imperative to select potential drugs that, after being effectively analyzed in cell lines and clinical trials, these can be considered for treatment of complex symptoms of COVID-19 patients, and for co-therapies with drugs directly targeting SARS-CoV-2.","authors":["López-Cortés A","Guevara-Ramírez P","Kyriakidis NC","Barba-Ostria C","Cáceres ÁL","Guerrero S","Munteanu CR","Tejera E","Ortiz-Prado E","Cevallos-Robalino D","Gómez J AM","Simbaña-Rivera K","Granizo-Martínez A","Pérez-M G","García-Cárdenas JM","Zambrano AK","Moreno S","Pérez-Castillo Y","Cabrera-Andrade A","Andrés LPS","Proaño-Castro C","Bautista J","Varela N","Quiñones LA","Paz-y-Miño C."],"year":2020,"journal":"PPR","source":"PPR","preprint":true}],"preprints":[{"pmid":"","doi":"10.20944/preprints202512.1011.v3","title":"Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance","abstract":"Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement. While numerous peptide drugs have undergone a rigorous approval process that evaluates both safety and efficacy, a parallel \"gray market\" of unapproved compounds has emerged, operating largely outside regulatory oversight. Our objective is to present the pharmacological mechanisms, safety profiles, and regulatory status of prominent approved and unapproved peptides marketed direct to patients, including AOD-9604 (Anti-Obesity Drug 9604), BPC-157 (Body Protection Compound 157), CJC-1295, FS-344 (Follistatin-344), GHK-Cu (Glycyl-L-histidyl-L-lysine copper), ipamorelin, MOTS-C (Mitochondrial ORF of the 12S rRNA type-c), sermorelin, SS-31 (Elamipretide), tesamorelin (Egrifta), Tβ4 (thymosin beta-4), and TB-500 (thymosin beta-4 fragment). Many unapproved peptides demonstrate favorable tissue repair and metabolic outcomes in animal models, but rigorous human safety data is scarce, and there is potential for serious harm to patients. This narrative review focuses on the utilization of peptides in sports medicine, and alternative treatments that may be considered. We provide a framework to navigate patient discussions about peptides to better facilitate evidence-based practices for musculoskeletal healing and athletic performance. We also discuss the placebo effect as a mediator of peptide efficacy, and how social media amplifies this effect.","authors":["Mendias CL","Awan TM."],"year":2026,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.20944/preprints202604.1748.v1","title":"Evaluation of Research Grade Peptides Marketed Directly to Consumers Reveals Extensive Variability in Purity and Measured Abundance","abstract":"Peptides are a rapidly expanding drug class with a parallel and largely unregulated gray market that sells preparations directly to consumers for self-administration. The use of gray market peptides has grown substantially, with patients self-administering these compounds for purported benefits including accelerated musculoskeletal injury recovery, muscle hypertrophy, fat loss, and athletic performance enhancement. The objective of this study was to evaluate the purity, measured abundance, and endotoxin burden of gray market research peptides using a large, publicly available independent testing dataset, and to compare their cost to compounded and FDA-approved alternatives. A total of 6441 peptide samples across fourteen compounds, including BPC-157, cagrilintide, CJC-1295, GHK-Cu, ipamorelin, PT-141, retatrutide, semaglutide, sermorelin, survodutide, TB-500, tesamorelin, thymosin beta-4, and tirzepatide, were analyzed. Two quality acceptance frameworks were applied: a model that approximated regulatory standards for 503A compounded medications, and a more conservative model that utilized regulatory standards often applied to the production of FDA approved peptide drugs. Between the two models, 41.6% to 71.1% of samples failed to meet basic quality criteria, and measurable endotoxin contamination was present in 15% of samples. Gray market compounds were consistently less expensive than FDA-approved peptides, but there were considerable differences in the cost differential. Compared with gray market preparations, the estimated cost of a clinically relevant treatment course for FDA-approved peptides was 72.8% higher for tirzepatide, and 3850% higher for PT-141. These findings indicate that many peptides used for sports medicine and performance-related purposes fail basic quality benchmarks. Further, consumer-directed third-party testing improves transparency, but captures only a small fraction of the safety profile relevant to patients self-administering injectable peptide preparations.","authors":["Mendias CL","Awan TM."],"year":2026,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.20944/preprints202512.1011.v1","title":"Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance","abstract":"Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement. While numerous peptide drugs have undergone a rigorous approval process that evaluates both safety and efficacy, a parallel \"gray market\" of unapproved compounds has emerged, operating largely outside regulatory oversight. Our objective is to present the pharmacological mechanisms, safety profiles, and regulatory status of prominent approved and unapproved peptides marketed direct to patients, including AOD-9604 (Anti-Obesity Drug 9604), BPC-157 (Body Protection Compound 157), CJC-1295, FS-344 (Follistatin-344), GHK-Cu (Glycyl-L-histidyl-L-lysine copper), Ipamorelin, MOTS-C (Mitochondrial ORF of the 12S rRNA type-c), sermorelin, SS-31 (Elamipretide), tesamorelin (Egrifta), and TB-500 (Thymosin Beta-4 fragment). Many unapproved peptides demonstrate favorable tissue repair and metabolic outcomes in animal models, rigorous human safety data is scarce, and there is potential for serious harm. This review focuses on peptide utilization in sports medicine and alternative treatments for specific peptides. We provide a framework to navigate patient discussions about peptides to better facilitate evidence-based practices for musculoskeletal healing and athletic performance. We also discuss the placebo effect as a mediator of peptide efficacy, and how social media amplifies this effect.","authors":["Mendias CL","Awan TM."],"year":2025,"journal":"PPR","source":"PPR","preprint":true},{"pmid":"","doi":"10.26434/chemrxiv.12408074.v1","title":"In Silico Analyses of Immune System Protein Interactome Network, Single-Cell RNA Sequencing of Human Tissues, and Artificial Neural Networks Reveal Potential Therapeutic Targets for Drug Repurposing Against COVID-19","abstract":"There is pressing urgency to better understand the immunological underpinnings of the coronavirus disease 2019 (COVID-19) caused by the severe acute respiratory syndrome coronavirus clade 2 (SARS-CoV-2) in order to identify potential therapeutic targets and drugs that allow treating patients effectively. To fill in this gap, we performed in silico analyses of immune system protein interactome network, single-cell RNA sequencing of human tissues, and artificial neural networks to reveal potential therapeutic targets for drug repurposing against COVID-19. As results, the high-confidence protein interactome network was conformed by 1,588 nodes between immune system proteins and human proteins physically associated with SARS-CoV-2. Subsequently, we screened all these nodes in ACE2 and TMPRSS2 co-expressing cells according to the Alexandria Project, finding 75 potential therapeutic targets significantly overexpressed (Z score > 2) in nasal goblet secretory cells, lung type II pneumocytes, and ileal absorptive enterocytes of patients with several immunopathologies. Then, we performed fully connected deep neural networks to find the best multitask classification model to predict the activity of 10,672 drugs for 25 of the 75 aforementioned proteins. On one hand, we obtained 45 approved drugs, 16 compounds under investigation, and 35 experimental compounds with the highest area under the receiver operating characteristic (AUROCs) for 15 immune system proteins. On the other hand, we obtained 4 approved drugs, 9 compounds under investigation, and 16 experimental compounds with the highest multi-target affinities for 9 immune system proteins. In conclusion, computational structure-based drug discovery focused on immune system proteins is imperative to select potential drugs that, after being effectively analyzed in cell lines and clinical trials, these can be considered for treatment of complex symptoms of COVID-19 patients, and for co-therapies with drugs directly targeting SARS-CoV-2.","authors":["López-Cortés A","Guevara-Ramírez P","Kyriakidis NC","Barba-Ostria C","Cáceres ÁL","Guerrero S","Munteanu CR","Tejera E","Ortiz-Prado E","Cevallos-Robalino D","Gómez J AM","Simbaña-Rivera K","Granizo-Martínez A","Pérez-M G","García-Cárdenas JM","Zambrano AK","Moreno S","Pérez-Castillo Y","Cabrera-Andrade A","Andrés LPS","Proaño-Castro C","Bautista J","Varela N","Quiñones LA","Paz-y-Miño C."],"year":2020,"journal":"PPR","source":"PPR","preprint":true}],"consensus_view":"The literature consensus is that tesamorelin is a clinically effective, well-tolerated GHRHR agonist whose primary structural vulnerability is proteolytic degradation (addressed in part by the N-terminal trans-3-hexenoyl cap) and whose activity is contingent on intact GRF(1-29) sequence engagement with GHRHR. There is no literature on helical stapling of tesamorelin or related GRF analogues in the retrieved corpus. The broader consensus on α-helical peptide stapling (not represented in these specific papers) supports the concept that i,i+4 all-hydrocarbon staples can increase helicity and protease resistance, but whether such modifications preserve or enhance GHRHR binding affinity for this specific peptide is not addressed by any retrieved paper. The clinical literature does not engage with structural modification strategies beyond the existing N-terminal hexenoyl group.","knowledge_gaps":"Several critical gaps exist: (1) No published structural data on the tesamorelin–GHRHR complex (co-crystal or cryo-EM) is represented in the retrieved literature, making it impossible to confirm from these sources whether Val-13 and Leu-17 are on the solvent-exposed face of the helix and whether the staple would avoid key receptor contact residues. (2) The conformational dynamics of tesamorelin in solution—degree of pre-existing helicity in the central region—are entirely unstudied in these papers, so the magnitude of entropic benefit from stapling is unknown. (3) No SAR data for the central helix (residues 10–20) of tesamorelin or GRF(1-29) analogues appears in the retrieved corpus, leaving open the question of whether Val-13 and Leu-17 are pharmacologically tolerated substitution sites. (4) The effect of hydrocarbon staples on GHRHR-specific pharmacology (agonist vs. partial agonist vs. antagonist outcomes) has not been explored for this target in any retrieved paper. (5) In vivo protease resistance and pharmacokinetic profiles of stapled GRF analogues are entirely absent from this literature set.","supporting_evidence":"The clinical literature consistently identifies proteolytic lability as a key limitation of tesamorelin, supporting protease resistance as a valuable design objective (PMID:22298602, PMID:19243281, PMID:21668043). The N-terminal trans-3-hexenoyl modification is the existing 'proof of concept' that structural modifications to tesamorelin can improve stability without abolishing GHRHR agonism, providing indirect support for the notion that additional modifications (e.g., central helix stapling) may be tolerated. The subcutaneous-only route of administration and need for daily injection (PMID:21668043, PMID:38905488) are direct clinical motivations for developing a more proteolytically stable analogue with potentially improved pharmacokinetics. The gray-market quality analysis (10.20944/preprints202604.1748.v1) further underscores that stability and structural integrity are practical concerns for tesamorelin formulations.","challenging_evidence":"No retrieved paper provides direct evidence that the central α-helix of tesamorelin tolerates substitution at positions 13 and 17, or that (S)-2-(4'-pentenyl)alanine residues at these positions would not disrupt receptor binding. The retrieved literature contains no SAR studies for the GRF(1-29) central helix, so the assumption that Val-13 and Leu-17 are on the solvent-exposed (non-receptor-contacting) face cannot be confirmed from these sources. Furthermore, the C-terminal recognition motif described in the hypothesis is not discussed in any retrieved paper, leaving its sensitivity to conformational perturbation from an upstream staple uncharacterized. The preprint literature (10.20944/preprints202512.1011.v3) notes that many peptide modifications with favorable preclinical profiles fail to translate to human outcomes, which is a general caution. Additionally, none of the retrieved papers discuss ruthenium-catalyzed ring-closing metathesis or hydrocarbon stapling in any peptide context, meaning the entire mechanistic rationale for the modification strategy must be imported from literature outside this retrieved set—representing a significant evidentiary gap rather than direct support."},"caveats":["in silico prediction only — requires wet lab validation","single-run prediction (not ensembled)","predicted properties may not reflect real-world biological behavior","this is research, not medical advice","(S)-2-(4'-pentenyl)alanine (S5) staple residues are outside AlphaFold2's training distribution — the low pLDDT almost certainly reflects model incompatibility with non-canonical cross-linking chemistry, not chemical infeasibility of the staple","ipTM 0.17 means no interpretable peptide–receptor interface was predicted; no conclusions about binding pose, staple face orientation, or receptor contact preservation can be drawn","heuristic stability score, aggregation propensity, and half-life estimates are sequence-based and do not account for the conformational or protease-shielding effects of the hydrocarbon staple cross-link","no published cryo-EM or co-crystal structure of tesamorelin–GHRHR complex is available; the assumption that Val-13 and Leu-17 are on the solvent-exposed non-contacting face remains unverified in the literature retrieved"],"works_cited":[{"pmid_or_doi":"38905488","title":"Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors.","year":2024,"relevance":"Confirms ongoing clinical relevance and GHRHR-mediated efficacy of tesamorelin in reducing visceral fat; reinforces the therapeutic value of improving this peptide's pharmacological properties."},{"pmid_or_doi":"21283099","title":"Tesamorelin.","year":2011,"relevance":"Provides foundational description of tesamorelin as a GRF analogue and its FDA approval context, establishing the baseline pharmacological identity of the molecule to be modified."},{"pmid_or_doi":"22298602","title":"Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy.","year":2012,"relevance":"Detailed pharmacological review describing tesamorelin's mechanism of action at GHRHR, N-terminal modification rationale, and subcutaneous-only route due to proteolytic lability—directly relevant to the protease resistance hypothesis."},{"pmid_or_doi":"21668043","title":"Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy.","year":2011,"relevance":"Covers pharmacological properties including structural basis of activity and tolerability; supports the premise that protease resistance and conformational stability are important parameters for tesamorelin optimization."},{"pmid_or_doi":"19243281","title":"Tesamorelin, a human growth hormone releasing factor analogue.","year":2009,"relevance":"Early review of tesamorelin development, including rationale for GRF analogue design over recombinant GH; highlights the importance of stability improvements as a design driver."},{"pmid_or_doi":"10.20944/preprints202512.1011.v3","title":"Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance","year":2026,"relevance":"Places tesamorelin within the broader peptide therapeutics landscape and summarizes its approved mechanism; limited direct relevance to stapling hypothesis but provides regulatory and pharmacological context."},{"pmid_or_doi":"10.20944/preprints202604.1748.v1","title":"Evaluation of Research Grade Peptides Marketed Directly to Consumers Reveals Extensive Variability in Purity and Measured Abundance","year":2026,"relevance":"Identifies purity and stability issues in unregulated tesamorelin preparations; peripherally supports the rationale that structural stabilization (e.g., stapling) could improve pharmacological reliability."}]},"onchain":{"hash":"2iU52mPods1MYdtbu9CkFip12rwV8YYG6Va7UJ9WXNxiKJ5JdEW3W2mPXp1wLijZrHSHjvu1RB1tJn33xjkxhk2z","signature":"2iU52mPods1MYdtbu9CkFip12rwV8YYG6Va7UJ9WXNxiKJ5JdEW3W2mPXp1wLijZrHSHjvu1RB1tJn33xjkxhk2z","data_hash":"420a02a400758e997f2d54472403f4eb66ccca399e1116c95dc77170b0e8e5a4","logged_at":"2026-05-04T03:34:36.755059+00:00","explorer_url":"https://solscan.io/tx/2iU52mPods1MYdtbu9CkFip12rwV8YYG6Va7UJ9WXNxiKJ5JdEW3W2mPXp1wLijZrHSHjvu1RB1tJn33xjkxhk2z"},"ipfs_hash":null,"created_at":"2026-05-04T03:29:41.392218+00:00","updated_at":"2026-05-04T03:34:36.761849+00:00"}